DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13133 and HSP17.6II

Sequence 1:NP_609343.1 Gene:CG13133 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_196763.1 Gene:HSP17.6II AraportID:AT5G12020 Length:155 Species:Arabidopsis thaliana

Alignment Length:100 Identity:24/100 (24%)
Similarity:49/100 (49%) Gaps:12/100 (12%)


  Fly    87 FKVVLDVHHFQISELTVKAKNSDTVCVEG-KQADDRAEKGQLCITRE-----FTRSYKLPRHYDA 145
            :..|:|:...:..|:.|:.:|.:.:.|.| :|.:::..:|...:..|     |.|.::||.:.|.
plant    56 YAFVVDMPGIKGDEIKVQVENDNVLVVSGERQRENKENEGVKYVRMERRMGKFMRKFQLPENADL 120

  Fly   146 TQARATFSADGILMITV-----PAPPKLDDVEREI 175
            .:..|. ..||:|.:||     |.|.|...::.::
plant   121 DKISAV-CHDGVLKVTVQKLPPPEPKKPKTIQVQV 154

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 21/87 (24%)
HSP17.6IINP_196763.1 IbpA <46..136 CDD:223149 20/81 (25%)
HSP20 48..153 CDD:278440 24/98 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2516
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1187096at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.