DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13133 and Hspb3

Sequence 1:NP_609343.1 Gene:CG13133 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_113938.1 Gene:Hspb3 RGDID:68345 Length:152 Species:Rattus norvegicus

Alignment Length:150 Identity:38/150 (25%)
Similarity:61/150 (41%) Gaps:27/150 (18%)


  Fly    31 ESKCRQRHYYLSHDLDVCARDFHL------RMDDSAWCHGSCLVGRVVIETGTEPDSLGRGTFKV 89
            |:..|.:..:.:..|:.|..|..|      .::|.....|:........::...|...|:..|::
  Rat    11 ETPVRYQEEFEARGLEDCRLDHALYALPGPTIEDLRKARGTPKALAEDSDSAETPPGEGKSRFQI 75

  Fly    90 VLDVHHF-------QISE--LTVKAKNSDTVCVEGKQADDRAEKGQLCITREFTRSYKLPRHYDA 145
            :|||..|       |..|  |.:||::       |.:.|:..     .|:|.|||.||||...:.
  Rat    76 LLDVVQFLPEDIIIQTFEGWLLIKAQH-------GTRMDEHG-----FISRSFTRQYKLPDGVET 128

  Fly   146 TQARATFSADGILMITVPAP 165
            ....|....||||::.|..|
  Rat   129 KDLSAILCHDGILVVEVKDP 148

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 27/85 (32%)
Hspb3NP_113938.1 ACD_HspB3_Like 65..147 CDD:107232 29/94 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.