DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13133 and Hspb2

Sequence 1:NP_609343.1 Gene:CG13133 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_077761.3 Gene:Hspb2 MGIID:1916503 Length:182 Species:Mus musculus

Alignment Length:118 Identity:38/119 (32%)
Similarity:50/119 (42%) Gaps:24/119 (20%)


  Fly    82 LGRGTFKVVLDVHHFQISELTVK-AKNSDTVCVEGKQADDRAEKGQLCITREFTRSYKLPRHYDA 145
            |..|.|:..|||.||...|:||: ..|...|.....|..||    ...::|||.|:|.||...|.
Mouse    69 LSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDR----HGFVSREFCRTYVLPADVDP 129

  Fly   146 TQARATFSADGILMI-------------------TVPAPPKLDDVEREIEIEP 179
            .:.||..|.||||.:                   .:||||..::.|....:||
Mouse   130 WRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEIARVEP 182

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 29/96 (30%)
Hspb2NP_077761.3 alpha-crystallin-Hsps_p23-like 67..148 CDD:320797 31/83 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR45640
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.970

Return to query results.
Submit another query.