DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13133 and Hsp27

Sequence 1:NP_609343.1 Gene:CG13133 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001287001.1 Gene:Hsp27 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster

Alignment Length:223 Identity:70/224 (31%)
Similarity:99/224 (44%) Gaps:46/224 (21%)


  Fly     8 DWEH---------DHEHGHHHWQPPRRHW---STGESKCRQRHYYLSHDLDVCARDFHLRMDDSA 60
            ||.|         .|.|...|   |||..   :.|..:.|...|..||       ..|.:|...|
  Fly    20 DWGHLLEDDFGFGVHAHDLFH---PRRLLLPNTLGLGRRRYSPYERSH-------GHHNQMSRRA 74

  Fly    61 WCHGSCLVGRVVIETGTEPDSLGRGTFKVVLDVHHFQISELTVKAKNSDTVCVEGKQADDRAEKG 125
            ....:.|:           .::|:..|:|.:||..|:.:|||||..: :||.||||.  :..|.|
  Fly    75 SGGPNALL-----------PAVGKDGFQVCMDVSQFKPNELTVKVVD-NTVVVEGKH--EEREDG 125

  Fly   126 QLCITREFTRSYKLPRHYDATQARATFSADGILMITVPAPPKLDDV--EREIEIEPTGNYFGSVS 188
            ...|.|.|.|.|.||:.:|..:..:|.|:||:|.:..|.||..:..  ||.::|:.||....||.
  Fly   126 HGMIQRHFVRKYTLPKGFDPNEVVSTVSSDGVLTLKAPPPPSKEQAKSERIVQIQQTGPAHLSVK 190

  Fly   189 DPTAPKAIEQADVDGDGGEANPAGTAMD 216
            .| ||:|       |||...|.:|..|:
  Fly   191 AP-APEA-------GDGKAENGSGEKME 210

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 31/76 (41%)
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 32/80 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2516
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45640
RoundUp 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.