DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13133 and hsp-16.11

Sequence 1:NP_609343.1 Gene:CG13133 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_505357.1 Gene:hsp-16.11 WormBaseID:WBGene00002017 Length:145 Species:Caenorhabditis elegans

Alignment Length:163 Identity:36/164 (22%)
Similarity:66/164 (40%) Gaps:32/164 (20%)


  Fly    17 HHHWQPPRRHWSTGESKCRQRHYYLSHDLDVCARDFHLRMDDSAWCHGSCLVGRVVIETGTEPDS 81
            :|:::|.:|. ..|:         |..|:....|.|      :..|.||......::....:   
 Worm     4 YHYFRPAQRS-VFGD---------LMRDMAQMERQF------TPVCRGSPSESSEIVNNDQK--- 49

  Fly    82 LGRGTFKVVLDVHHFQISELTVKAKNSDTVCVEGKQADDRAEKGQLCITREFTRSYKLPRHYDAT 146
                 |.:.|:|..|:..:|.:.. :..|:.::|:| :.:.|.|.  ..:.|:|...||...|..
 Worm    50 -----FAINLNVSQFKPEDLKINL-DGHTLSIQGEQ-ELKTEHGY--SKKSFSRVILLPEDVDVG 105

  Fly   147 QARATFSADGILMITVPAPPKLDDVE-REIEIE 178
            ...:..|.||.|.|..   ||.:.:: |.|.|:
 Worm   106 AVASNLSEDGKLSIEA---PKKEAIQGRSIPIQ 135

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 20/76 (26%)
hsp-16.11NP_505357.1 IbpA 17..134 CDD:223149 31/147 (21%)
metazoan_ACD 42..123 CDD:107247 21/96 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.