DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13133 and Hspb1

Sequence 1:NP_609343.1 Gene:CG13133 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_038588.2 Gene:Hspb1 MGIID:96240 Length:209 Species:Mus musculus

Alignment Length:114 Identity:45/115 (39%)
Similarity:58/115 (50%) Gaps:7/115 (6%)


  Fly    87 FKVVLDVHHFQISELTVKAKNSDTVCVEGKQADDRAEKGQLCITREFTRSYKLPRHYDATQARAT 151
            ::|.|||:||...|||||.|.. .|.:.||..:.:.|.|.  |:|.|||.|.||...|.|...::
Mouse    99 WRVSLDVNHFAPEELTVKTKEG-VVEITGKHEERQDEHGY--ISRCFTRKYTLPPGVDPTLVSSS 160

  Fly   152 FSADGILMITVPAP-PKLDDVEREIEIEPTGNYFGSVSDPTAPKAIEQA 199
            .|.:|.|  ||.|| ||......||.|..|......:..|.|.|: ||:
Mouse   161 LSPEGTL--TVEAPLPKAVTQSAEITIPVTFEARAQIGGPEAGKS-EQS 206

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 32/76 (42%)
Hspb1NP_038588.2 Interaction with TGFB1I1. {ECO:0000250} 74..209 45/115 (39%)
ACD_HspB1_like 88..173 CDD:107230 34/79 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45640
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.