DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG13133 and hspb6

Sequence 1:NP_609343.1 Gene:CG13133 FlyBaseID:FBgn0032181 Length:217 Species:Drosophila melanogaster
Sequence 2:XP_002940672.2 Gene:hspb6 XenbaseID:XB-GENE-876273 Length:168 Species:Xenopus tropicalis

Alignment Length:104 Identity:39/105 (37%)
Similarity:47/105 (45%) Gaps:3/105 (3%)


  Fly    74 ETGTEPDSLGRGTFKVVLDVHHFQISELTVKAKNSDTVCVEGKQADDRAEKGQLCITREFTRSYK 138
            |.|.....|.:..|.|:|||.||...|||||.. .|.|.|..|..:...|.|  .|:|||.|.||
 Frog    63 EAGLSEVKLDKDQFSVLLDVKHFSPEELTVKVV-GDYVEVHAKHEERPDEHG--FISREFHRRYK 124

  Fly   139 LPRHYDATQARATFSADGILMITVPAPPKLDDVEREIEI 177
            :|.........:..||:|:|.|..|........||.|.|
 Frog   125 IPPTVSPAAISSALSAEGLLSIQAPVTAGGKQEERSIPI 163

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG13133NP_609343.1 metazoan_ACD 87..163 CDD:107247 31/76 (41%)
hspb6XP_002940672.2 Crystallin 1..54 CDD:278926
ACD_HspB4-5-6 68..149 CDD:107233 32/84 (38%)
IbpA <74..163 CDD:223149 35/92 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.