DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SoYb and BoYb

Sequence 1:NP_001245959.1 Gene:SoYb FlyBaseID:FBgn0051755 Length:1476 Species:Drosophila melanogaster
Sequence 2:NP_649430.1 Gene:BoYb FlyBaseID:FBgn0037205 Length:1059 Species:Drosophila melanogaster

Alignment Length:1103 Identity:247/1104 (22%)
Similarity:443/1104 (40%) Gaps:238/1104 (22%)


  Fly   393 SNNRTVVFSMDKMEQIFNDMLGKNPSERSVQKNRSQMPNSNVSTTKRCVEKMHVCRSENMGDRKP 457
            |:.:|...|.|.:.::.:...|:|.:...|..|                                
  Fly     5 SDEKTWQSSRDSVYEVGDSYSGQNANRPLVATN-------------------------------- 37

  Fly   458 SVCLKHLVLAHSPEPVNPVTSYKELPLGNTILNAMDDLNFQTPLPTQIYAWPHLV---NRGSLVL 519
              |.::.| ||:...:.||..:.|:.|...||..|.:|.....|..|.|.||||.   ..|::::
  Fly    38 --CSEYAV-AHANCQLRPVRRFAEVSLLPDILETMRNLGLNRLLRLQSYTWPHLAGGSGHGAMIV 99

  Fly   520 VNPSGTGRSWSYLPVICSSV---LSSF----ENVTSNLDTRIAPGPLAILIVDSVENAKKLASHC 577
            .:|: :||:::|:|.:|.:|   |..|    |:|..::......||:|:::|..:....::::.|
  Fly   100 GSPA-SGRTFAYIPPVCHAVSRALMDFTGQCEDVEHDISQPDRYGPIALILVPDLRRVHQVSAMC 163

  Fly   578 EFLMK-----DFNTQNLKVVNTHAHSMMDVYMMLLNSCGVLVTTLAHLNNILSNELPLVNPTRLE 637
            ..|::     |..|..|.|.:|.:...   ::.|||..|.||.|.|.|.........|:....|:
  Fly   164 LALLRKAHKNDSVTLALNVSSTKSSQF---FLKLLNGVGCLVATPAQLVWFWQEAPGLMRFPCLQ 225

  Fly   638 FIIFDDYDRKRLDNAELLKEVFQKVNSIGGL--SKQLVLVAQQWHSERFQKLLNRTTKPLILFGD 700
            |:::||.|   |.:.|.|::|.|.:..|..|  |.|:|:|::.:......||.....||.::|||
  Fly   226 FLVYDDVD---LMSREQLQDVQQVLQEILPLSHSPQVVMVSKSYCHTLMSKLRAVNDKPALVFGD 287

  Fly   701 FLEAALYGGLKFNVTLRSSALKARQLLDILAEQDGSKKRTLIYCKNQMELEELSAILIEAGLQCV 765
            .||||||||.:..:::..|..||..::.:|.:....:.||:|:|.:..:::.|.|.|......|:
  Fly   288 ILEAALYGGTRIRISIMRSEAKANAVVQMLQQCSPEEFRTVIFCSDDGDMQCLVAALEVQHYSCL 352

  Fly   766 ------------DISKAQNQSPNRLMLVDDSQVRKQLPVRNIQLLIHFSLPESWLRFSRRFHTMA 818
                        .:...|.:|...::|..|:  ..:|.:|:...:||.|:..||.:|..|...::
  Fly   353 PYYQTADLEVRQQVHSWQARSNGVILLCTDN--CPELDIRDAHTIIHHSMSHSWSKFKLRHLKIS 415

  Fly   819 DNIRNLFTKPIGR--GQDLITYILMDENNAKEWPRIMKFLQDHGLTTQSMPDSEQQLDNTL---- 877
            ||:.|: .||...  .:.|.:.:|:|:||.::.||::.|||.|......:.:..:::...|    
  Fly   416 DNLCNM-VKPTASIVKKPLYSLVLLDDNNHRQLPRLVDFLQLHQKVDHRLVEVAKRIRQELGKAR 479

  Fly   878 ----PYCPYKLSNGNCNRNQCNKRHHFLKTD-----LPKIGNPLLQPGTLIRCKFLKAYDPAHMA 933
                ..|...|..|.|....|..||.....|     ||..|:        ::.:.:|.|.|.|..
  Fly   480 NDQHQLCDQILVLGKCYDPVCESRHRLSHIDRRPDYLPASGD--------VKVQLVKVYSPTHFC 536

  Fly   934 VMPMKYKSKDSTIWIDVPYPSYPSTLVFKMSFGVPRKVHNPCKINDVCFVQHKELLSRVRIV--- 995
            |..:::.....| |..:.|.:.....:.......||:...|. ...:|.........|||::   
  Fly   537 VRLLEHLPPKGT-WRMMEYSAVQEFRMQLTQIKEPRRYWPPV-AGAICMYHTTFTKERVRVLKVA 599

  Fly   996 ----DNPARPQVTVQL--MDYGTELLQVKASQLLECPEQFRDLQQLAMDIRLSGLAGSGQGGMWS 1054
                .|..:..:||:|  :|..|.:......:|.||||..:....||.|:||.|         |.
  Fly   600 AIKNTNIVQSDLTVKLQALDVDTRIFSTNCGKLFECPEALQQEAPLACDLRLPG---------WV 655

  Fly  1055 T--DSIQWVQDRFADIN--------EEIMQITVDFGVLDVAYVKEIALIEECPTMLTSVYKTFLR 1109
            .  ....|.::...::|        :..:|..:.|......:|:::..|     |....:|..:|
  Fly   656 PYFGERSWTEENIRNVNLILTQLPKDHFLQAKILFVAAGTLFVQDLVAI-----MYADQFKAHVR 715

  Fly  1110 --------------------KELLRQGFAKI-----------DSTSILELRAIHEQWKQEMEELR 1143
                                .|::|:.||::           ||......:. ||:.|.:|.:..
  Fly   716 HLSLARRLVEATLVKRSENAAEMIREFFAEVIIEDDIDENVQDSKEKANSKP-HEKMKGKMTDQP 779

  Fly  1144 ANKENIVCSSTDLDNRDSKITSLQNKQATCSSGKEEDLNPVETPLIIASPNSNETLEERKHVSDK 1208
            |..:    |...|..|..::.::.::     |.||..|              ::.|:||::.:.:
  Fly   780 AKLQ----SQPPLSGRCLRLANMAHE-----SVKENQL--------------HQELQERRYETPE 821

  Fly  1209 VQNKIDELNDFNKSVEIEHVQDASPLDSSTALINTLIHELNTKSPTKK------KNTQEFIKNIV 1267
            :.::.:| :|..:|.|....|      ....::|....:|..:|...|      ..:.||.|.:.
  Fly   822 IPHQSNE-SDIPQSNEDRFSQ------LYECIMNCASLQLEDESKPAKHPDHVLSESVEFHKIMT 879

  Fly  1268 HEDETQSIHHEISSSTNSLKQDKTIVVGPQDPPKELFLQYLNCATKSRESVYPMVKWHQTLTHIE 1332
            :||.|..  |         .|:||          .|.|...|.|.       |.|.::||:|.:|
  Fly   880 NEDATPD--H---------TQEKT----------ALLLLPNNVAR-------PSVTYYQTMTTLE 916

  Fly  1333 LVV--EQQMLEYKLGLDGNTLEYKVNETTPPQRFILNLLGEVRI------DSVKQHGYYLHIK 1387
            ..|  .:...:||..|.|..|.::.  .:.....||..:..:|.      .:::....|:.:|
  Fly   917 FQVFLPEDDHDYKALLLGAQLFFRA--ISKSSDLILQFIMTLRFPYSSMSHNIRGRTVYISVK 977

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SoYbNP_001245959.1 TUDOR 7..115 CDD:278965
SrmB 475..877 CDD:223587 120/433 (28%)
P-loop_NTPase 480..>646 CDD:304359 51/181 (28%)
TUDOR 927..1043 CDD:278965 30/125 (24%)
BoYbNP_649430.1 P-loop_NTPase 81..263 CDD:304359 55/189 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130879421
eggNOG 1 0.900 E2759_KOG0334
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR22655
RoundUp 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.