DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SoYb and Ddx46

Sequence 1:NP_001245959.1 Gene:SoYb FlyBaseID:FBgn0051755 Length:1476 Species:Drosophila melanogaster
Sequence 2:NP_001268984.1 Gene:Ddx46 MGIID:1920895 Length:1032 Species:Mus musculus

Alignment Length:736 Identity:135/737 (18%)
Similarity:271/737 (37%) Gaps:178/737 (24%)


  Fly   210 SFEKAEINDMAIDTRPRLRRILELVVLLSENAKESTPTPSA--IQQKKLDALLQSHETYLIPNSV 272
            |.||||..|.:.:.:.            .::.||......|  ..|.||:..::           
Mouse   120 SKEKAEGGDSSKEKKK------------DKDDKEDEKEKDAGNFDQNKLEEEMR----------- 161

  Fly   273 KLLSKVQSISESSMQTALAN---RSKQISKELPHKANQSEDN---------RKKEVKYLESENLS 325
            |...:|:...|...:.|:.|   ..|:|.:....|....||:         .:||...:|.|.|.
Mouse   162 KRKERVEKWREEQRKKAMENIGELKKEIEEMKQGKKWSLEDDDDDEDDPAEAEKEGTEMEDEELD 226

  Fly   326 ECLSKVKLSSYQQKNTDSSTLSGPRNLASSSTNSNSNVRKSMTLFKSSGAHLTTSLSVPLTENCT 390
                  .|.:|.::..:.......|::...:.|.           |.||..:|..::|..|:...
Mouse   227 ------PLDAYMEEVKEEVKKFNMRSVKGGAGNE-----------KKSGPTVTKVVTVVTTKKAV 274

  Fly   391 NQSNNR----------TVVFSMDKME-QIFNDMLGKNPSERSV--------------QKN-RSQM 429
            ..::.:          .:.:|.::.| .:...:.|....:|.:              :|| ..::
Mouse   275 VDADKKKGELMENDQDAMEYSSEEEEVDLQTALTGYQTKQRKLLEPVDHGKIEYEPFRKNFYVEV 339

  Fly   430 PNSNVSTTKRCVEKMHVCRSENMG-DRKPSVCLKHLVLAHSPEPVNPVTSYKELPLGNTILNAMD 493
            |    ...|...|:::|.|.|..| ..|...|.|            |:.|:.:..:...|||::.
Mouse   340 P----ELAKMSQEEVNVFRLEMEGITVKGKGCPK------------PIKSWVQCGISMKILNSLK 388

  Fly   494 DLNFQTPLPTQIYAWPHLVNRGSLVLVNPSGTGRSWSYLPVICSSVLSSFENVTSNLDTRIAPGP 558
            ...::.|.|.|..|.|.:::...|:.:..:|:|::.::|       |..|.::..........||
Mouse   389 KHGYEKPTPIQTQAIPAIMSGRDLIGIAKTGSGKTIAFL-------LPMFRHIMDQRSLEEGEGP 446

  Fly   559 LAILIVDSVENAKKLASHCEFLMKDFNTQNLKVVNTHAHS-MMDVYMMLLNSCGVLVTTLAHLNN 622
            :|:::..:.|.|.::...|:...|   |..|:||..:..: :.:....|.....::|.|...:.:
Mouse   447 IAVIMTPTRELALQITKECKKFSK---TLGLRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMID 508

  Fly   623 IL-SNELPLVNPTRLEFIIFDDYDRKRLDNAELLKEVFQKVNSIGGLSKQLVLVAQQWHSERFQK 686
            :| :|...:.|..|:.:::.|:.||           :|..     |...|::.:......:|...
Mouse   509 MLAANSGRVTNLRRVTYVVLDEADR-----------MFDM-----GFEPQVMRIVDNVRPDRQTV 557

  Fly   687 LLNRT-------------TKPL-ILFGDFLEAALYGGLKFNVTLRSSALKARQLLDILA--EQDG 735
            :.:.|             :||: :..|.  .:.:...::..|.:.....|..:||::|.  ::.|
Mouse   558 MFSATFPRAMEALARRILSKPIEVQVGG--RSVVCSDVEQQVIVIEEEKKFLKLLELLGHYQESG 620

  Fly   736 SKKRTLIYCKNQMELEELSAILIEAGLQCVDISKAQNQ-----------SPNRLMLVDDSQVRKQ 789
            |   .:|:...|...:.|...|:.|...|:.:....:|           :....:||..|...:.
Mouse   621 S---VIIFVDKQEHADGLLKDLMRASYPCMSLHGGIDQYDRDSIINDFKNGTCKLLVATSVAARG 682

  Fly   790 LPVRNIQLLIHFSLPESWLRFSRRFHTMADNIRNLFTKPIGR----GQDLITYILMDENNAKEWP 850
            |.|:::.|::::|.|..:..:..|               .||    |.....|..:.|:.|:...
Mouse   683 LDVKHLILVVNYSCPNHYEDYVHR---------------AGRTGRAGNKGYAYTFITEDQARYAG 732

  Fly   851 RIMKFLQDHGLTTQSMPDSEQ 871
            .|:|.|:..|  |...||.|:
Mouse   733 DIIKALELSG--TAVPPDLEK 751

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SoYbNP_001245959.1 TUDOR 7..115 CDD:278965
SrmB 475..877 CDD:223587 82/431 (19%)
P-loop_NTPase 480..>646 CDD:304359 34/168 (20%)
TUDOR 927..1043 CDD:278965
Ddx46NP_001268984.1 SrmB 344..826 CDD:223587 91/469 (19%)
Q motif 372..400 7/28 (25%)
DEADc 378..581 CDD:238167 42/229 (18%)
DEAD box 529..532 1/3 (33%)
Helicase_C 618..714 CDD:278689 20/114 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0334
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.