DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: SoYb and rde-12

Sequence 1:NP_001245959.1 Gene:SoYb FlyBaseID:FBgn0051755 Length:1476 Species:Drosophila melanogaster
Sequence 2:NP_001256533.1 Gene:rde-12 WormBaseID:WBGene00010280 Length:959 Species:Caenorhabditis elegans

Alignment Length:446 Identity:83/447 (19%)
Similarity:190/447 (43%) Gaps:91/447 (20%)


  Fly   476 VTSYKELPLGNTILNAMDDLNFQTPLPTQIYAWPHLVNRGSLVLVNPSGTGRSWSY-LPVICSSV 539
            :||:....|..|||..:..:.:......|....|.:::...::....:..|::.:: ||:| ..:
 Worm   379 LTSWTNSGLHPTILETLKRIKYNNVRTIQGAMIPQVLDGHDVLGQAETSAGKTAAFGLPII-DKI 442

  Fly   540 LSSFENVTSNLDTRIAPGPLAILIVDSVENA----KKLASHCEFLMKDFNTQNLKVV----NTHA 596
            |...|...:.  .|...||||:::..:.|.|    :.|.::|:      ||..:.::    :..|
 Worm   443 LRMDEETRNK--ARQDDGPLALILAPTRELAAQIHEALRTYCQ------NTDIIVLLSYGQSDRA 499

  Fly   597 HSMMDVYMMLLNSCGVLVTTLAHLNNI-LSNELPLVNPTRLEFIIFDDYDRKRLDNAELLKEVFQ 660
            .|:.::    .|.|.:|:.|...:.:. :.:.:.|::   |.|::||:.||       ||:::  
 Worm   500 RSLNEI----RNGCDILIGTCGRIMDFTVKSHISLLH---LRFLVFDEADR-------LLQDM-- 548

  Fly   661 KVNSIGGL--------------SKQLVLVAQQWHSERFQKLLNRTTKPLILFGDFLEAALYGG-L 710
            |.:.:|.|              ::|.::.:..:::. ...:.|...|.|....:.::..|..| |
 Worm   549 KKDPLGHLGAIIKDAGFMESAATRQTIMTSATFNAS-VMTVANELMKRLPGQDEMIKIVLANGRL 612

  Fly   711 KFNVTL-----RSSALKARQLLDILAEQ-DGSKKRTLIYCKNQMELEELSAILIEAGL--QCVDI 767
            ...|.|     :..|.|..:|.:||.:. :|...:|:|:.:.:.:.:..:|.|...|:  |.:..
 Worm   613 SKRVNLEFFECKGLAEKNAKLREILKQNVNGKTLKTIIFVQKKDQCDACAAKLTSGGMLAQTLHG 677

  Fly   768 SKAQNQ--------SPNRL-MLVDDSQVRKQLPVRNIQLLIHFSLP--------ESWLRFSRRFH 815
            .::|:.        ..||: :||....:.:.:.|.::..:|:|.||        ::::..:.|  
 Worm   678 DRSQDMREKLINDFKSNRVNLLVTTDLLSRGIDVSDLDRVINFDLPDGDPDQGADTFIHRAGR-- 740

  Fly   816 TMADNIRNLFTKPIGRGQDLITYILMDENNAKE---WPRIMKFLQDHGLTTQSMPD 868
                      |...||.::.:....:|..:.::   .|::::.:....|....:||
 Worm   741 ----------TGRTGRKENGLCVSFVDPQSDRDSLLAPKLVELIISQNLPDLKVPD 786

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SoYbNP_001245959.1 TUDOR 7..115 CDD:278965
SrmB 475..877 CDD:223587 83/447 (19%)
P-loop_NTPase 480..>646 CDD:304359 35/176 (20%)
TUDOR 927..1043 CDD:278965
rde-12NP_001256533.1 PTZ00110 230..799 CDD:240273 83/447 (19%)
P-loop_NTPase 382..594 CDD:304359 43/238 (18%)
HELICc 628..755 CDD:238034 25/139 (18%)
Nucleoporin_FG <867..950 CDD:290362
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG0334
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.