DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31712 and AT1G10890

Sequence 1:NP_609327.3 Gene:CG31712 FlyBaseID:FBgn0051712 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_172558.4 Gene:AT1G10890 AraportID:AT1G10890 Length:288 Species:Arabidopsis thaliana

Alignment Length:301 Identity:108/302 (36%)
Similarity:159/302 (53%) Gaps:39/302 (13%)


  Fly     3 SRSRTPSPSGKRRHHKSKHKKRSKSHHDHERPSTRTDRDKS-SEVNNHGRHRERDRDRERDRHRS 66
            ||||:||||..||...|:...|       :|.|.|:.||:| |..::|...|.:.|.....||||
plant     6 SRSRSPSPSPSRRRKHSRSPVR-------QRHSRRSRRDRSPSPYSSHSYSRRKSRSISPRRHRS 63

  Fly    67 DRHTERDYRHSPSILKSRKRSSSSSSDSQYSEQESQRSKQKRSRFKKLDEQNQMQVERL--AEME 129
            ...|.:  |.||:..:.:::.|.||:.          |..|||....|:.......|:|  .|.|
plant    64 RSVTPK--RRSPTPKRYKRQKSRSSTP----------SPAKRSPAATLESAKNRNGEKLKREEEE 116

  Fly   130 RQRRAKELEQKTIEEEAAKRIEMLVKKRVEEELEKRRDEIEQEVNRRVETAKAEMEREMMLELER 194
            |:||.:|.|.|.||||..||:|..::|:|||.|:.  ::|:.|:...:|..:..:..|:..:||.
plant   117 RKRRQREAELKLIEEETVKRVEEAIRKKVEESLQS--EKIKMEILTLLEEGRKRLNEEVAAQLEE 179

  Fly   195 RREQIREEERRRE--------EDEKQKREELEEILAENNRKIEEAQRKLA-------EERLAIIE 244
            .:|....|.:.:|        |.|:|::||.|.|..||.:::||||||.|       |||...:|
plant   180 EKEASLIEAKEKEGVMRCLSQEREQQEKEERERIAEENLKRVEEAQRKEAMERQRKEEERYRELE 244

  Fly   245 EQRLMDEERQRMRKEQEKRVKEEQKVILGKNNSRPKLSFSL 285
            |.:...||..|.:|.:|:..:.:|..:||||.|||||||:|
plant   245 ELQRQKEEAMRRKKAEEEEERLKQMKLLGKNKSRPKLSFAL 285

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31712NP_609327.3 SPFH_like <96..185 CDD:302763 30/91 (33%)
ARGLU 135..276 CDD:291991 55/156 (35%)
AT1G10890NP_172558.4 ARGLU 126..276 CDD:291991 53/152 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T124664
orthoMCL 1 0.900 OOG5_132587
Panther 1 1.100 LDO PTHR31711
Phylome 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.