DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31712 and AT1G10890

DIOPT Version :9

Sequence 1:NP_609327.3 Gene:CG31712 / 34320 FlyBaseID:FBgn0051712 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_172558.4 Gene:AT1G10890 / 837632 AraportID:AT1G10890 Length:288 Species:Arabidopsis thaliana


Alignment Length:301 Identity:108/301 - (35%)
Similarity:159/301 - (52%) Gaps:39/301 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SRSRTPSPSGKRRHHKSKHKKRSKSHHDHERPSTRTDRDKS-SEVNNHGRHRERDRDRERDRHRS 66
            ||||:||||..||...|:...|       :|.|.|:.||:| |..::|...|.:.|.....||||
plant     6 SRSRSPSPSPSRRRKHSRSPVR-------QRHSRRSRRDRSPSPYSSHSYSRRKSRSISPRRHRS 63

  Fly    67 DRHTERDYRHSPSILKSRKRSSSSSSDSQYSEQESQRSKQKRSRFKKLDEQNQMQVERL--AEME 129
            ...|.:  |.||:..:.:::.|.||:.          |..|||....|:.......|:|  .|.|
plant    64 RSVTPK--RRSPTPKRYKRQKSRSSTP----------SPAKRSPAATLESAKNRNGEKLKREEEE 116

  Fly   130 RQRRAKELEQKTIEEEAAKRIEMLVKKRVEEELEKRRDEIEQEVNRRVETAKAEMEREMMLELER 194
            |:||.:|.|.|.||||..||:|..::|:|||.|:.  ::|:.|:...:|..:..:..|:..:||.
plant   117 RKRRQREAELKLIEEETVKRVEEAIRKKVEESLQS--EKIKMEILTLLEEGRKRLNEEVAAQLEE 179

  Fly   195 RREQIREEERRRE--------EDEKQKREELEEILAENNRKIEEAQRKLA-------EERLAIIE 244
            .:|....|.:.:|        |.|:|::||.|.|..||.:::||||||.|       |||...:|
plant   180 EKEASLIEAKEKEGVMRCLSQEREQQEKEERERIAEENLKRVEEAQRKEAMERQRKEEERYRELE 244

  Fly   245 EQRLMDEERQRMRKEQEKRVKEEQKVILGKNNSRPKLSFSL 285
            |.:...||..|.:|.:|:..:.:|..:||||.|||||||:|
plant   245 ELQRQKEEAMRRKKAEEEEERLKQMKLLGKNKSRPKLSFAL 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31712NP_609327.3 ARGLU 135..285 CDD:405931 62/164 (38%)
AT1G10890NP_172558.4 ARGLU 126..276 CDD:291991 52/151 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 112 1.000 Domainoid score I2061
eggNOG 1 0.900 - - E1_2BZMG
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I1668
OMA 1 1.010 - - QHG60126
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2617
orthoMCL 1 0.900 - - OOG6_107421
Panther 1 1.100 - - LDO PTHR31711
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.