DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31712 and AT5G13340

Sequence 1:NP_609327.3 Gene:CG31712 FlyBaseID:FBgn0051712 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_196838.1 Gene:AT5G13340 AraportID:AT5G13340 Length:242 Species:Arabidopsis thaliana

Alignment Length:291 Identity:90/292 (31%)
Similarity:146/292 (50%) Gaps:66/292 (23%)


  Fly     5 SRTPSPSGKRRHHKSKHKKRSKSHHDHERPSTRTDRDKSSEVNNHGRHRERDRDRERDRHRSDRH 69
            ||:.|||.:||:.:|              |.|                           |||.|.
plant     6 SRSRSPSHRRRYSRS--------------PVT---------------------------HRSSRR 29

  Fly    70 TERDYRHSPSILKSRKRSSSSSSDSQYSEQESQRSKQKRSRFKKLD-EQNQMQVERLAEMERQRR 133
            |.||...||  ..||.:.|.|.:..|:          :|.|...|. .::::.:|...|.|.:.|
plant    30 TRRDRSRSP--YTSRHKKSRSPAPRQH----------QRDRSSSLSPSEHRIAIEVKKEQEDKAR 82

  Fly   134 AK-ELEQKTIEEEAAKRIEMLVKKRVEEELEKRRDEIEQEVNRRVETAKAEMEREMMLELERRRE 197
            .: |.|.|.:|||.|:|||..|:|.|||.:  :.:|:::|:.||.:.|..:|..::.::|::.:|
plant    83 LQHEAELKRLEEETAQRIEEAVRKNVEERM--KTEEVKEEIERRTKEAYEKMFLDVEIQLKKEKE 145

  Fly   198 QIREEERRREEDEKQKREELEEILAENNRKIEEAQRKLA-------EERLAIIE-EQRLMDEERQ 254
            ....|.||:||..:::||||:::|.||:|::||:||:.|       |||...:| .||..:|..:
plant   146 AALNEARRKEEQARREREELDKMLEENSRRVEESQRREAMELQRKEEERYRELELLQRQKEEAAR 210

  Fly   255 RMRKEQEKRVKEEQKVILGKNNSRPKLSFSL 285
            |.:.|:|:.::...|:..| |.||.||.|.:
plant   211 RKKLEEEEEIRNSSKLSNG-NRSRSKLHFGM 240

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31712NP_609327.3 SPFH_like <96..185 CDD:302763 28/91 (31%)
ARGLU 135..276 CDD:291991 54/150 (36%)
AT5G13340NP_196838.1 ARGLU 85..231 CDD:291991 54/149 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I1947
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T124664
orthoMCL 1 0.900 OOG5_132587
Panther 1 1.100 O PTHR31711
Phylome 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.