DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31712 and ARGLU1

Sequence 1:NP_609327.3 Gene:CG31712 FlyBaseID:FBgn0051712 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_060481.3 Gene:ARGLU1 HGNCID:25482 Length:273 Species:Homo sapiens

Alignment Length:301 Identity:144/302 (48%)
Similarity:191/302 (63%) Gaps:46/302 (15%)


  Fly     1 MG-SRSRTPSPSGKRRHHKSKHKKRSKSHHDHERPSTRTDRDKSSEVNNHGRHRERDRDRERDRH 64
            || ||||:.|        :|||.|.||  |:.:|                .|.|.|.||:||.|.
Human     1 MGRSRSRSSS--------RSKHTKSSK--HNKKR----------------SRSRSRSRDKERVRK 39

  Fly    65 RS-DRHTERDYRHSPSILKSRKRSSSSSSDSQYSEQESQRSKQKRSRF----------KKLDE-Q 117
            || .|.::|:.|.     :||.||.|:::.....|::.:|:.....|.          ..||| |
Human    40 RSKSRESKRNRRR-----ESRSRSRSTNTAVSRRERDRERASSPPDRIDIFGRTVSKRSSLDEKQ 99

  Fly   118 NQMQVERLAEMERQR--RAKELEQKTIEEEAAKRIEMLVKKRVEEELEKRRDEIEQEVNRRVETA 180
            .:.:.|:.||.||||  |.:|:|:|.||||.|:|:|.||.||||||||||:||||:||.||||.|
Human   100 KREEEEKKAEFERQRKIRQQEIEEKLIEEETARRVEELVAKRVEEELEKRKDEIEREVLRRVEEA 164

  Fly   181 KAEMEREMMLELERRREQIREEERRREEDEKQKREELEEILAENNRKIEEAQRKLAEERLAIIEE 245
            |..||::::.||||:|:.....::.|||:|:.||||||.||.||||||.|||.|||||:|.|:||
Human   165 KRIMEKQLLEELERQRQAELAAQKAREEEERAKREELERILEENNRKIAEAQAKLAEEQLRIVEE 229

  Fly   246 QRLMDEERQRMRKEQEKRVKEEQKVILGKNNSRPKLSFSLK 286
            ||.:.|||.::.:|::::.|||||:||||..||||||||||
Human   230 QRKIHEERMKLEQERQRQQKEEQKIILGKGKSRPKLSFSLK 270

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31712NP_609327.3 SPFH_like <96..185 CDD:302763 50/102 (49%)
ARGLU 135..276 CDD:291991 86/141 (61%)
ARGLU1NP_060481.3 ARGLU 130..269 CDD:339464 87/139 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C289626648
eggNOG 1 0.900 E1_2BZMG
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 226 1.000 Inparanoid score I3440
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006120
OrthoInspector 1 1.000 T1074370
orthoMCL 1 0.900 OOG5_132587
Panther 1 1.100 LDO PTHR31711
Phylome 1 0.910 0.714 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4802
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.830

Return to query results.
Submit another query.