DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31712 and arglu1a

Sequence 1:NP_609327.3 Gene:CG31712 FlyBaseID:FBgn0051712 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_998381.2 Gene:arglu1a ZFINID:ZDB-GENE-040426-2914 Length:251 Species:Danio rerio

Alignment Length:253 Identity:121/254 (48%)
Similarity:167/254 (66%) Gaps:15/254 (6%)


  Fly    40 RDKSSEVNNHGRH-RERDRDRERDRHRSDRHTERDYRHSPSILKSRKRSSSSSSD--SQYSEQES 101
            |.:||..:.|.:| |:|.|.:.:.:.||.....:..|.|.|...||:....|..|  ..:....|
Zfish     5 RSRSSSRSKHSKHSRKRSRSKSKSKKRSRSKEPKRNRRSRSRSGSRRDRGGSPPDRTDMFGWTLS 69

  Fly   102 QRS---KQKRSRFKKLDEQNQMQVERLAEMERQRRAKELEQKTIEEEAAKRIEMLVKKRVEEELE 163
            :|:   ||||.     :|..::::||    :|:.|.:|:|::.||||.|:|:|.||.:|||||||
Zfish    70 KRNNDEKQKRE-----EEDRRVEIER----QRKIRQQEIEERLIEEETARRVEELVARRVEEELE 125

  Fly   164 KRRDEIEQEVNRRVETAKAEMEREMMLELERRREQIREEERRREEDEKQKREELEEILAENNRKI 228
            |||||||.||.||||.||..||.:::.||||.|:.....::.|||:||.||.|||.||.||||||
Zfish   126 KRRDEIEHEVLRRVEEAKRIMEAQLLQELERLRQAELNAQKAREEEEKSKRVELERILEENNRKI 190

  Fly   229 EEAQRKLAEERLAIIEEQRLMDEERQRMRKEQEKRVKEEQKVILGKNNSRPKLSFSLK 286
            .:||.||||::|.|:||||.:.|||.::.:|::|:.|||||:||||..|||:||||||
Zfish   191 ADAQAKLAEDQLRIVEEQRKIHEERMKLEQERQKQQKEEQKMILGKGKSRPRLSFSLK 248

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31712NP_609327.3 SPFH_like <96..185 CDD:302763 45/92 (49%)
ARGLU 135..276 CDD:291991 84/141 (60%)
arglu1aNP_998381.2 ARGLU 108..238 CDD:291991 78/130 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C289628113
eggNOG 1 0.900 E1_2BZMG
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 226 1.000 Inparanoid score I3400
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006120
OrthoInspector 1 1.000 T597565
orthoMCL 1 0.900 OOG5_132587
Panther 1 1.100 O PTHR31711
Phylome 1 0.910 0.600 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4802
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.830

Return to query results.
Submit another query.