DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31712 and arglu1

Sequence 1:NP_609327.3 Gene:CG31712 FlyBaseID:FBgn0051712 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_989280.1 Gene:arglu1 XenbaseID:XB-GENE-5857929 Length:265 Species:Xenopus tropicalis

Alignment Length:300 Identity:141/300 (47%)
Similarity:188/300 (63%) Gaps:52/300 (17%)


  Fly     1 MG-SRSRTPSPSGKRRHHKSKHKKRSKSHHDHERPSTRTDRDKSSEVNNHGRHRERDRDRERDRH 64
            || ||||:.|        :|||.|..|                      |.:.|.|.|::||.|.
 Frog     1 MGRSRSRSSS--------RSKHAKSGK----------------------HNKKRSRSREKERVRK 35

  Fly    65 RS-DRHTERDYRHSPSILKSRKRSSSSSSDSQYSEQESQ---------RSKQKRSRFKKLDE-QN 118
            || .|.::|:.|.     :||.||.|:::..:..|:.:.         |:..|||   .||| |.
 Frog    36 RSKSRESKRNRRR-----ESRSRSRSNTASRRERERAASPPDRIDIFGRTVSKRS---SLDEKQK 92

  Fly   119 QMQVERLAEMERQRRAK--ELEQKTIEEEAAKRIEMLVKKRVEEELEKRRDEIEQEVNRRVETAK 181
            :...|:.||.|||||.:  |:|:|.||||.|:|:|.||.||||||||||:||||:||.||||.||
 Frog    93 REDEEKKAEYERQRRIRQQEIEEKLIEEETARRVEELVAKRVEEELEKRKDEIEREVLRRVEEAK 157

  Fly   182 AEMEREMMLELERRREQIREEERRREEDEKQKREELEEILAENNRKIEEAQRKLAEERLAIIEEQ 246
            ..||::::.||||:|:.....::.|||:|:.||||||.||.||||||.:||.|||||:|.|:|||
 Frog   158 RIMEKQLLEELERQRQAELAAQKAREEEERAKREELERILEENNRKIADAQAKLAEEQLKIVEEQ 222

  Fly   247 RLMDEERQRMRKEQEKRVKEEQKVILGKNNSRPKLSFSLK 286
            |.:.|||.::.:|::::.|||||:||||..||||||||||
 Frog   223 RKIHEERMKLEQERQRQQKEEQKIILGKGKSRPKLSFSLK 262

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31712NP_609327.3 SPFH_like <96..185 CDD:302763 52/101 (51%)
ARGLU 135..276 CDD:291991 85/143 (59%)
arglu1NP_989280.1 ARGLU 122..252 CDD:291991 78/130 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C289628095
eggNOG 1 0.900 E1_2BZMG
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 221 1.000 Inparanoid score I3332
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006120
OrthoInspector 1 1.000 T1060448
Phylome 1 0.910 0.600 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4802
TreeFam 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.