DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31712 and arglu1b

Sequence 1:NP_609327.3 Gene:CG31712 FlyBaseID:FBgn0051712 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_956456.1 Gene:arglu1b ZFINID:ZDB-GENE-040426-736 Length:269 Species:Danio rerio

Alignment Length:300 Identity:142/300 (47%)
Similarity:190/300 (63%) Gaps:48/300 (16%)


  Fly     1 MG-SRSRTPSPSGKRRHHKSKHKKRSKSHHDHERPSTRTDRDKSSEVNNHGRHRERDRDRERDRH 64
            || ||||:.|        :|||.|.||  |..:|                .|.|.|.|||||.|.
Zfish     1 MGRSRSRSSS--------RSKHSKTSK--HSKKR----------------SRSRSRSRDRERKRR 39

  Fly    65 RSDRHTERDYRHSPSILKSRKRSSSSSSDSQYSEQESQ----------RSKQKRSRFKKLDE-QN 118
            ...|.::|:.|.     :||.||.|:::.|:...:.:.          |:..|||   .:|| |.
Zfish    40 SKSRESKRNRRR-----ESRSRSRSNTATSRRDRERAASPPERIDIFGRALSKRS---AVDEKQK 96

  Fly   119 QMQVERLAEMERQRRAK--ELEQKTIEEEAAKRIEMLVKKRVEEELEKRRDEIEQEVNRRVETAK 181
            :.:.|:..|||||||.:  |:|::.||||.|:|:|.||.||||||||||:||||:||.||||.||
Zfish    97 KEEEEKKVEMERQRRIRQQEIEERLIEEETARRVEELVAKRVEEELEKRKDEIEREVLRRVEEAK 161

  Fly   182 AEMEREMMLELERRREQIREEERRREEDEKQKREELEEILAENNRKIEEAQRKLAEERLAIIEEQ 246
            ..||::::.||||:|......::.|||:||.||||||:||.:|||||.:||.||||::|.|:|||
Zfish   162 RIMEKQLLEELERQRHAELAAQKAREEEEKSKREELEKILVDNNRKIADAQAKLAEDQLRIVEEQ 226

  Fly   247 RLMDEERQRMRKEQEKRVKEEQKVILGKNNSRPKLSFSLK 286
            |.:.|||.::.:|::|:.|||||:||||..||||||||||
Zfish   227 RKIHEERMKLEQERQKQQKEEQKMILGKGKSRPKLSFSLK 266

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31712NP_609327.3 SPFH_like <96..185 CDD:302763 49/102 (48%)
ARGLU 135..276 CDD:291991 84/143 (59%)
arglu1bNP_956456.1 ARGLU 126..256 CDD:291991 78/130 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C289629855
eggNOG 1 0.900 E1_2BZMG
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 226 1.000 Inparanoid score I3400
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006120
OrthoInspector 1 1.000 T597565
orthoMCL 1 0.900 OOG5_132587
Panther 1 1.100 LDO PTHR31711
Phylome 1 0.910 0.714 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4802
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.830

Return to query results.
Submit another query.