DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31712 and Arglu1

Sequence 1:NP_609327.3 Gene:CG31712 FlyBaseID:FBgn0051712 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_001020143.1 Gene:Arglu1 RGDID:1310061 Length:271 Species:Rattus norvegicus

Alignment Length:299 Identity:146/300 (49%)
Similarity:192/300 (64%) Gaps:44/300 (15%)


  Fly     1 MG-SRSRTPSPSGKRRHHKSKHKKRSKSHHDHERPSTRTDRDKSSEVNNHGRHRERDRDRERDRH 64
            || ||||:.|        :|||.|.||  |:.:|                .|.|.|.||:||.|.
  Rat     1 MGRSRSRSSS--------RSKHTKSSK--HNKKR----------------SRSRSRSRDKERVRK 39

  Fly    65 RS-DRHTERDYRHSPSILKSRKRSSSSSSDSQYSEQESQRSKQKR--------SRFKKLDE-QNQ 119
            || .|.::|:.|.     :||.||.|:::.:...|:|...|...|        |:...||| |.:
  Rat    40 RSKSRESKRNRRR-----ESRSRSRSTNAAASRRERERASSPPDRIDIFGRTVSKRSSLDEKQKR 99

  Fly   120 MQVERLAEMERQR--RAKELEQKTIEEEAAKRIEMLVKKRVEEELEKRRDEIEQEVNRRVETAKA 182
            .:.|:.||.||||  |.:|:|:|.||||.|:|:|.||.||||||||||:||||:||.||||.||.
  Rat   100 EEEEKKAEFERQRKIRQQEIEEKLIEEETARRVEELVAKRVEEELEKRKDEIEREVLRRVEEAKR 164

  Fly   183 EMEREMMLELERRREQIREEERRREEDEKQKREELEEILAENNRKIEEAQRKLAEERLAIIEEQR 247
            .||::::.||||:|:.....::.|||:|:.||||||.||.||||||.|||.|||||:|.|:||||
  Rat   165 IMEKQLLEELERQRQAELAAQKAREEEERAKREELERILEENNRKIAEAQAKLAEEQLRIVEEQR 229

  Fly   248 LMDEERQRMRKEQEKRVKEEQKVILGKNNSRPKLSFSLK 286
            .:.|||.::.:|::::.|||||:||||..||||||||||
  Rat   230 KIHEERMKLEQERQRQQKEEQKIILGKGKSRPKLSFSLK 268

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31712NP_609327.3 SPFH_like <96..185 CDD:302763 52/100 (52%)
ARGLU 135..276 CDD:291991 86/141 (61%)
Arglu1NP_001020143.1 ARGLU 128..267 CDD:339464 87/139 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C289629938
eggNOG 1 0.900 E1_2BZMG
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 228 1.000 Inparanoid score I3334
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006120
OrthoInspector 1 1.000 T1088015
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR31711
Phylome 1 0.910 0.714 Consistency score
TreeFam 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.