DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31712 and Arglu1

Sequence 1:NP_609327.3 Gene:CG31712 FlyBaseID:FBgn0051712 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_789819.2 Gene:Arglu1 MGIID:2442985 Length:271 Species:Mus musculus

Alignment Length:299 Identity:146/300 (49%)
Similarity:192/300 (64%) Gaps:44/300 (15%)


  Fly     1 MG-SRSRTPSPSGKRRHHKSKHKKRSKSHHDHERPSTRTDRDKSSEVNNHGRHRERDRDRERDRH 64
            || ||||:.|        :|||.|.||  |:.:|                .|.|.|.||:||.|.
Mouse     1 MGRSRSRSSS--------RSKHTKSSK--HNKKR----------------SRSRSRSRDKERVRK 39

  Fly    65 RS-DRHTERDYRHSPSILKSRKRSSSSSSDSQYSEQESQRSKQKR--------SRFKKLDE-QNQ 119
            || .|.::|:.|.     :||.||.|:::.:...|:|...|...|        |:...||| |.:
Mouse    40 RSKSRESKRNRRR-----ESRSRSRSTNAAASRRERERASSPPDRIDIFGRTVSKRSSLDEKQKR 99

  Fly   120 MQVERLAEMERQR--RAKELEQKTIEEEAAKRIEMLVKKRVEEELEKRRDEIEQEVNRRVETAKA 182
            .:.|:.||.||||  |.:|:|:|.||||.|:|:|.||.||||||||||:||||:||.||||.||.
Mouse   100 EEEEKKAEFERQRKIRQQEIEEKLIEEETARRVEELVAKRVEEELEKRKDEIEREVLRRVEEAKR 164

  Fly   183 EMEREMMLELERRREQIREEERRREEDEKQKREELEEILAENNRKIEEAQRKLAEERLAIIEEQR 247
            .||::::.||||:|:.....::.|||:|:.||||||.||.||||||.|||.|||||:|.|:||||
Mouse   165 IMEKQLLEELERQRQAELAAQKAREEEERAKREELERILEENNRKIAEAQAKLAEEQLRIVEEQR 229

  Fly   248 LMDEERQRMRKEQEKRVKEEQKVILGKNNSRPKLSFSLK 286
            .:.|||.::.:|::::.|||||:||||..||||||||||
Mouse   230 KIHEERMKLEQERQRQQKEEQKIILGKGKSRPKLSFSLK 268

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31712NP_609327.3 SPFH_like <96..185 CDD:302763 52/100 (52%)
ARGLU 135..276 CDD:291991 86/141 (61%)
Arglu1NP_789819.2 ARGLU 128..267 CDD:339464 87/139 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C289629212
eggNOG 1 0.900 E1_2BZMG
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 228 1.000 Inparanoid score I3437
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006120
OrthoInspector 1 1.000 T1084467
orthoMCL 1 0.900 OOG5_132587
Panther 1 1.100 LDO PTHR31711
Phylome 1 0.910 0.714 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4802
TreeFam 00.000 Not matched by this tool.
1110.830

Return to query results.
Submit another query.