DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG31712 and F44E2.3

Sequence 1:NP_609327.3 Gene:CG31712 FlyBaseID:FBgn0051712 Length:290 Species:Drosophila melanogaster
Sequence 2:NP_498950.1 Gene:F44E2.3 WormBaseID:WBGene00018417 Length:244 Species:Caenorhabditis elegans

Alignment Length:305 Identity:87/306 (28%)
Similarity:140/306 (46%) Gaps:87/306 (28%)


  Fly     1 MGSRSRTPSPSGKRRHHKSKHKKRSKSHHDHERPSTRTDRDKSSEVNNHGRHRERDRDRERDRHR 65
            |..|||:.|.|.||                        ||::..      |..:|||||||.|.|
 Worm     1 MSRRSRSRSRSPKR------------------------DREERK------RREDRDRDRERKRDR 35

  Fly    66 SDRHTERDYRHSPSILKSRKRSSSSSSDSQYSEQ-----ESQRSKQKRSRFKKL----------- 114
            .||  ||..||         |||||........|     ..:|.:::|:...||           
 Worm    36 KDR--ERKRRH---------RSSSSEGSQAEPHQLGSIFREERRRRERNESPKLPPPPPPPPSDP 89

  Fly   115 --DEQNQMQVERLAEMERQRRAKELEQKTIEEEAAKRIEMLVKKRVEEELEKRRDEIEQEVNRRV 177
              |......|..|.|..:    |.||:|.:|:.:| |:..| :..:.|:....|:|:|:.:    
 Worm    90 PVDTSIPFDVSTLNEPTK----KWLEEKIVEQVSA-RVHQL-EAMMAEKATSARNEMEKML---- 144

  Fly   178 ETAKAEMEREMMLELERRREQIREEERRREEDEKQKREELEEILAENNRKI---EEAQRKLAEER 239
               :|::|.||.:||        .|.::|:|:.::|.::||   ||..||:   ||:::|..|:|
 Worm   145 ---RAQIEAEMAVEL--------AECKKRDEESRKKCKQLE---AELERKVLEAEESRKKFEEDR 195

  Fly   240 LAIIEEQRLMDEERQRMRKEQEKRVKEEQKVILGKN-NSRPKLSF 283
            ||::|::..::.:|..:.:::....|.||:.||.|: |||..:.|
 Worm   196 LAMLEQKSQLERDRAELARQKSDMKKNEQQAILNKSGNSRAPIKF 240

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG31712NP_609327.3 SPFH_like <96..185 CDD:302763 22/107 (21%)
ARGLU 135..276 CDD:291991 43/145 (30%)
F44E2.3NP_498950.1 ARGLU 102..231 CDD:291991 45/153 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.