DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42366 and KDX1

DIOPT Version :8

Sequence 1:NP_723501.2 Gene:CG42366 / 34319 FlyBaseID:FBgn0259712 Length:706 Species:Drosophila melanogaster
Sequence 2:NP_012761.1 Gene:KDX1 / 853696 SGDID:S000001644 Length:433 Species:Saccharomyces cerevisiae

Alignment Length:432 Identity:115/432 - (26%)
Similarity:200/432 - (46%) Gaps:71/432 - (16%)


  Fly     1 MNRYITLT-QLGDGTYGTVVLGQRKDTGEK--VAIKRMKRKYYSWEEA-MNLREVKSLKKL-SHP 60
            :|::..|| ::|.|::..:......::.|:  |||:::...:.:.... ..|||:|.|:.| .||
Yeast    19 LNKHFHLTGKIGRGSHSLICSSTYTESNEETHVAIRKIPNAFGNKLSCKRTLRELKLLRHLRGHP 83

  Fly    61 NIVKLKE---VIRENDTL---YFVFEYMKENLYQMIKDRDTHLPEPELKSILFQVLTGLAFMHRH 119
            |||.|.:   |...|..|   |...|.|:.:|.|:|:. :..|.:...:|.::|:|..|.::|..
Yeast    84 NIVWLFDTDIVFYPNGALNGVYLYEELMECDLSQIIRS-EQRLEDAHFQSFIYQILCALKYIHSA 147

  Fly   120 GFFHRDLKPENLLCSGPDLIKIADFGLAREIRSRPPFTD-----YVSTRWYRAPEVLLHSTNYGS 179
            ...|.||||:|||.:....:||.:|||:..........|     |:::.||:|||:||:......
Yeast   148 NVLHCDLKPKNLLVNSDCQLKICNFGLSCSYSENHKVNDGFIKGYITSIWYKAPEILLNYQECTK 212

  Fly   180 TIDLWAMGCIMAELYTFRPLFPGSSEVDQLFKICSVLGTPDKDDWPDGYRLASMIHFRYPDCI-- 242
            .:|:|:.|||:|||...:|:|.|...||.|..|..:||||.::...:   :||...:.|   |  
Yeast   213 AVDIWSTGCILAELLGRKPMFEGKDYVDHLNHILQILGTPPEETLQE---IASQKVYNY---IFQ 271

  Fly   243 --KVP---LSSVVSRCSQNGLDLLEDMLAYDPDKRPTAQQSLKYPYFHALKRISPTAATKANVRL 302
              .:|   ..|::...:...|:||:.||.:||.||.|.:.:|::||......|....:.:...|.
Yeast   272 FGNIPGRSFESILPGANPEALELLKKMLEFDPKKRITVEDALEHPYLSMWHDIDEEFSCQKTFRF 336

  Fly   303 NSKYAAS-------------------NGHPVQSVS-NNVLPVQEKLQAVTELLHQTNNNMNSHSN 347
            ..::..|                   ..||:...| ::.|.:::.:......:|.:...:.|:| 
Yeast   337 EFEHIESMAELGNEVIKEVFDFRKVVRKHPISGDSPSSSLSLEDAIPQEVVQVHPSRKVLPSYS- 400

  Fly   348 LGKNNNLAPKNGGVPR-KYQPKLSFLTTSE-----MGAGSHA 383
                          |. .|..:|..|||::     ||..|::
Yeast   401 --------------PEFSYVSQLPSLTTTQPYQNLMGISSNS 428

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42366NP_723501.2 STKc_MAK_like 4..284 CDD:270824 94/302 (31%)
S_TKc 4..284 CDD:214567 94/302 (31%)
KDX1NP_012761.1 STKc_MPK1 22..355 CDD:173750 98/339 (29%)
S_TKc 23..318 CDD:214567 94/301 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112960766
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.