DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42366 and IME2

DIOPT Version :8

Sequence 1:NP_723501.2 Gene:CG42366 / 34319 FlyBaseID:FBgn0259712 Length:706 Species:Drosophila melanogaster
Sequence 2:NP_012429.1 Gene:IME2 / 853338 SGDID:S000003642 Length:645 Species:Saccharomyces cerevisiae

Alignment Length:600 Identity:169/600 (28%)
Similarity:279/600 (47%) Gaps:149/600 (25%)


  Fly     2 NRYITLTQLGDGTYGTV-----------VLGQRKD-------------------TGEKVAIKRMK 36
            :||..:.:||.|::|.|           :||::.|                   |...||||.|.
Yeast    36 DRYQLIEKLGAGSFGCVTLAKAQFPLSNILGKQHDIRGTLMDQPKNGHQNYITKTQGVVAIKTMM 100

  Fly    37 RKYYSWEEAMNLREVKSLKKL-SHPNIVKLKEVI--RENDTLYFVFEYMKENLYQMIKDRDTHL- 97
            .|.::.::...:||:|.:..: ::.:::::.||.  .||..|:.|.|.|::|||||:|.|...: 
Yeast   101 TKLHTLQDYTRVREIKFILAIPANDHLIQIFEVFIDSENYQLHIVMECMEQNLYQMMKHRRRRVF 165

  Fly    98 PEPELKSILFQVLTGLAFMHRHGFFHRDLKPENLLCSGPD------------------LIKIADF 144
            ..|.|||||.|:|.||..:|.|.||||||||||:|.: |.                  :||:|||
Yeast   166 SIPSLKSILSQILAGLKHIHEHNFFHRDLKPENILIT-PSTQYFEKEYMNQIGYQDNYVIKLADF 229

  Fly   145 GLAREIRSRPPFTDYVSTRWYRAPEVLLHSTNYGSTIDLWAMGCIMAELYTFRPLFPGSSEVDQL 209
            ||||.:.::.|:|.||||||||:||:||.|..|...:|:||.||:..|:..||.||||::|:||:
Yeast   230 GLARHVENKNPYTAYVSTRWYRSPEILLRSGYYSKPLDIWAFGCVAVEVTVFRALFPGANEIDQI 294

  Fly   210 FKICSVLGTPDKDD----------------WPDGYRLASMIHFRYPDCIKVPLSSVVSRCSQNGL 258
            :||..|||||.|..                |.|...|...::.:.|......|..::|....:.|
Yeast   295 WKILEVLGTPIKRSDFVNTNHITAPPPGGFWDDASNLVHKLNLKLPYVEGSSLDHLLSSSQLSDL 359

  Fly   259 -DLLEDMLAYDPDKRPTAQQSLKYPYFHALKRISPTAATKANVR---LNSKYA---------ASN 310
             ::::..|.:||::|.|||:..:.|:|      ..|.|::.:.|   .|::.|         |:|
Yeast   360 SEVVKKCLRWDPNERATAQELCEMPFF------ENTVASQVDARGNVTNTEQALIFAGINPVATN 418

  Fly   311 GHPVQSVSNNVLPVQEKLQAVTELLHQTNNNMNSHSNLGKNNNLAPKNGGVPRKYQPKLSFL--- 372
            ..|:...|:..||.:.:    :..:..:||:.:||:...            |...|.||:.:   
Yeast   419 TKPIYFNSSTKLPAETE----SNDIDISNNDHDSHAMCS------------PTLNQEKLTLVEFL 467

  Fly   373 -----------TTSEMGAGSHAD--------SSSLVGGATVDGVP---VPQH--QNGGESINDI- 412
                       :..::|..|...        |..:.....:..:|   |..|  .|..:..||| 
Yeast   468 NEFVEEDNDDHSIPDVGTDSTISDSIDETELSKEIRNNLALCQLPDEEVLDHSLSNIRQLTNDIE 532

  Fly   413 YLNR----NISQLF---GLPAGPQHQQQQQVH-HPNVSFSTTSSRNAGAIYVNGSHLSYDTANMN 469
            .:|:    |:.|||   .:|...:.|::|..: |.::      ..:....|||.|:.::...:.:
Yeast   533 IINKDEADNMEQLFFDLEIPEKDEFQRKQPFNEHADI------DEDIVLPYVNNSNYTHTDRSHH 591

  Fly   470 AKNNAKFVVGASNGG 484
            ..:|   |:|.::.|
Yeast   592 RGDN---VLGDASLG 603

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42366NP_723501.2 STKc_MAK_like 4..284 CDD:270824 121/349 (35%)
S_TKc 4..284 CDD:214567 121/349 (35%)
IME2NP_012429.1 STKc_MAK_like 38..386 CDD:270824 121/349 (35%)
S_TKc 38..386 CDD:214567 121/349 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001283
OrthoInspector 1 1.000 T1136479
orthoMCL 1 0.900 OOG5_127559
Panther 1 1.100 LDO PTHR24055
Phylome 1 0.910 0.800 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.770

Return to query results.
Submit another query.