DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42366 and AT4G19110

DIOPT Version :8

Sequence 1:NP_723501.2 Gene:CG42366 / 34319 FlyBaseID:FBgn0259712 Length:706 Species:Drosophila melanogaster
Sequence 2:NP_849407.1 Gene:AT4G19110 / 827649 AraportID:AT4G19110 Length:464 Species:Arabidopsis thaliana

Alignment Length:445 Identity:203/446 (46%)
Similarity:283/446 (63%) Gaps:59/446 (13%)


  Fly     1 MNRYITLTQLGDGTYGTVVLGQRKDTGEKVAIKRMKRKYYSWEEAMNLREVKSLKKLSHPNIVKL 65
            |:||..:.::||||:|:|.....|.|||.||||:||:|||||:|.:||||||||::::|||||||
plant     1 MDRYKLIKEVGDGTFGSVWRAINKQTGEVVAIKKMKKKYYSWDECINLREVKSLRRMNHPNIVKL 65

  Fly    66 KEVIRENDTLYFVFEYMKENLYQMIKDRDTHLPEPELKSILFQVLTGLAFMHRHGFFHRDLKPEN 130
            ||||||||.||||||||:.||||::|||.....|.::|:..|||..||::||:.|:|||||||||
plant    66 KEVIRENDILYFVFEYMECNLYQLMKDRQKLFAEADIKNWCFQVFQGLSYMHQRGYFHRDLKPEN 130

  Fly   131 LLCSGPDLIKIADFGLAREIRSRPPFTDYVSTRWYRAPEVLLHSTNYGSTIDLWAMGCIMAELYT 195
            ||.| .|:|||||||||||:.|.||||:||||||||||||||.|..|.|.:|:||||.|||||.:
plant   131 LLVS-KDIIKIADFGLAREVNSSPPFTEYVSTRWYRAPEVLLQSYVYTSKVDMWAMGAIMAELLS 194

  Fly   196 FRPLFPGSSEVDQLFKICSVLGTPDKDDWPDGYRLASMIHFRYPDCIKVPLSSVVSRCSQNGLDL 260
            .||:|||:||.|:::|||||:|||.::.|.:|..||:.|::::|....|||||::...|::.::|
plant   195 LRPIFPGASEADEIYKICSVIGTPTEETWLEGLNLANTINYQFPQLPGVPLSSLMPSASEDAINL 259

  Fly   261 LEDMLAYDPDKRPTAQQSLKYPYFHALKRISPTAATKANV---------RLNSKYAASNGHPVQS 316
            :|.:.::||..||||.:.|::|:|.:...:.|:...|.:|         |.:.::.:...:|| |
plant   260 IERLCSWDPSSRPTAAEVLQHPFFQSCFYVPPSLRPKPSVARTPPPVGPRGSFEHQSVKRYPV-S 323

  Fly   317 VSN------NVLP---------VQEKLQAVTELLHQTNNNMNSHSNL--------GKNNNLAPKN 358
            ::|      .|.|         ||.||..|.:  ..|.|.....|::        ||.   :|.|
plant   324 LANAKPFNSYVSPKSNAAFGSGVQRKLDMVNQ--DGTRNTKPVRSSVRDSKYRPPGKK---SPHN 383

  Fly   359 GGVPRKYQPKLSFLTTSE---------MGA-GSHADSSSLVGGATVDGVPVPQHQ 403
            .......:.:::..:.||         :|| ||...|.|:||          |||
plant   384 AAAASLNKNRVTRSSVSETADKLANMTIGATGSRRHSVSVVG----------QHQ 428

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42366NP_723501.2 STKc_MAK_like 4..284 CDD:270824 165/280 (59%)
S_TKc 4..284 CDD:214567 165/280 (59%)
AT4G19110NP_849407.1 STKc_MAK_like 4..283 CDD:270824 165/280 (59%)
S_TKc 4..283 CDD:214567 165/280 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 360 1.000 Inparanoid score I570
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T125148
orthoMCL 1 0.900 OOG5_127559
Panther 1 1.100 O PTHR24055
Phylome 1 0.910 0.794 Consistency score
54.960

Return to query results.
Submit another query.