DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42366 and nmo

DIOPT Version :8

Sequence 1:NP_723501.2 Gene:CG42366 / 34319 FlyBaseID:FBgn0259712 Length:706 Species:Drosophila melanogaster
Sequence 2:NP_001356976.1 Gene:nmo / 38890 FlyBaseID:FBgn0011817 Length:439 Species:Drosophila melanogaster

Alignment Length:347 Identity:105/347 - (30%)
Similarity:170/347 - (48%) Gaps:25/347 - (7%)


  Fly    10 LGDGTYGTVVLGQRKDTGEKVAIKRMKRKYYSWEEAMNL-REVKSLKKLSHPNIVKLKEVIREN- 72
            :|.|.:|.|........|.:||:|::...:.|...:..: ||:|.|....|.|::...::::.. 
  Fly    46 IGYGAFGVVWAVTDPRDGRRVALKKLPNVFQSLVSSKRVFRELKMLCFFKHENVLSALDILQPPH 110

  Fly    73 ----DTLYFVFEYMKENLYQMIKDRDTHLPEPELKSILFQVLTGLAFMHRHGFFHRDLKPENLLC 133
                ..:|.:.|.::.:|:::|.. ..||....:|..|:|:|.||.::|.....|||:||.|||.
  Fly   111 LDFFQEIYVITELLQSDLHKIIVS-PQHLSADHIKVFLYQILRGLKYLHSARILHRDIKPGNLLV 174

  Fly   134 SGPDLIKIADFGLAR--EIRSRPPFTDYVSTRWYRAPEVLLHSTNYGSTIDLWAMGCIMAELYTF 196
            :...::||.||||||  |.......|..|.|::|||||:|:.:.:|.|.:|:|::|||..||...
  Fly   175 NSNCVLKICDFGLARVEEPDQAKHMTQEVVTQYYRAPEILMGARHYSSAVDVWSVGCIFGELLGR 239

  Fly   197 RPLFPGSSEVDQLFKICSVLGTPDKDDWP---DGYRLASMIHFRYPDCIKVPLSSVVSRCSQNGL 258
            |.||...:.|.||..|..:||||..:|..   :|.|...:.....|....| |.::.|..:...:
  Fly   240 RILFQAQNPVQQLELITELLGTPTMEDMRHACEGARTHMLRRAPKPPSFSV-LYTLSSHATHEAV 303

  Fly   259 DLLEDMLAYDPDKRPTAQQSLKYPY-------FHALKRISPTAATKANVR-LNSKYAASNGHPVQ 315
            .||..||.:|||||.:...:|.:||       :|:. .......|.|.:| ..:.:..|.|.|..
  Fly   304 HLLCQMLVFDPDKRISVTDALAHPYLDEGRLRYHSC-MCKCCFTTSAGMRQYTADFEPSAGQPFD 367

  Fly   316 SVSNNVLPVQEKLQAVTELLHQ 337
            .:....|   ..:|.|.|.:|:
  Fly   368 DLWERKL---TSVQQVKEEMHK 386

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42366NP_723501.2 STKc_MAK_like 4..284 CDD:270824 93/291 (32%)
S_TKc 4..284 CDD:214567 93/291 (32%)
nmoNP_001356976.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C113010252
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24055
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.