DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42366 and SRPK

DIOPT Version :8

Sequence 1:NP_723501.2 Gene:CG42366 / 34319 FlyBaseID:FBgn0259712 Length:706 Species:Drosophila melanogaster
Sequence 2:NP_001260993.1 Gene:SRPK / 36706 FlyBaseID:FBgn0286813 Length:939 Species:Drosophila melanogaster

Alignment Length:799 Identity:162/800 (20%)
Similarity:260/800 (33%) Gaps:233/800 (29%)


  Fly     2 NRYITLTQLGDGTYGTVVLGQRKDTGEKVAIKRMKRKYYSWEEAMNLREVKSLKKL-----SHPN 61
            :||..:.:||.|.:.||.|.........||||.:|...:..|.|.:  |:|.||.:     |:|.
  Fly   168 DRYHVIRKLGWGHFSTVWLCWDLQAMGYVAIKIVKSAPHFAETARD--EIKILKTVRETDPSNPR 230

  Fly    62 IVKLKEVIRE------NDT-LYFVFEYMKENLYQMI-KDRDTHLPEPELKSILFQVLTGLAFMHR 118
            ..|..:::.:      |.| :..|||.:.:||.::| |.....:|...:|:|..|||.||.::|.
  Fly   231 RHKTVQMLDDFKITGVNGTHICMVFEVLGDNLLKLIRKSNYRGIPLANVKTITRQVLEGLDYLHT 295

  Fly   119 -HGFFHRDLKPEN-LLCSG----------------------PDLIKIADFGLAREIRSRPPFTDY 159
             ....|.|:|||| |||..                      |.|:..|    .:|.| .||.|..
  Fly   296 CCKIIHTDIKPENVLLCVDEPHVRSLATEATQLYCMNSKMYPSLVSRA----PKEYR-EPPITGK 355

  Fly   160 VS--------TRWYRAPEVLLHSTNYGSTIDLWAMGCIMAELYTFRPLFPGSSEVDQLFKICSVL 216
            :|        .:..:..|:.....:|....|  ..|.|            ..:||..     ...
  Fly   356 MSKNRKKKLKKKAKKRMELFKQQRDYLEQAD--GQGAI------------NPNEVQN-----GDA 401

  Fly   217 GTPDKDDWPDGYRLASMIHFRYPDCIKVPLSSVVSRCSQNGLDLLEDMLAYDPDKRPTAQQSLKY 281
            |..|.|::.|...:...:|.               ...|......|:..| .|::...||:.   
  Fly   402 GISDADEYFDANSVEDNVHV---------------AAGQPSRKQREERKA-PPEQSEEAQEQ--- 447

  Fly   282 PYFHALKRISPTAATKANVRLNSKYAASNGHPVQSVSNNVLPVQEKLQAVTELLHQTNNNMNSHS 346
               ..|...:..|..|...:..:|...|.|.....:.|:....:......::..:.:|:..|:.|
  Fly   448 ---DPLTEGTDKAKKKKKKKNKNKSNQSKGQQPPQLENSTSSAESSSALKSQQANGSNSTTNNKS 509

  Fly   347 NLGKNNNLAPKNGGVPRKYQPKLSFLTTSEMGAGSH----------ADSSSLVGGATVDGVPVPQ 401
            |...:..|..::.|.....:||      .|....:|          ::|.|.:...:|       
  Fly   510 NTNSSGTLKGQSNGKKMPLRPK------QEKQGSNHQLNNNNSKPNSNSDSKISSGSV------- 561

  Fly   402 HQNGGESINDIYLNRNISQLFGLPAGPQ--HQQQQ-------QVH--------------HPNVSF 443
             :|...:.|..:.|   |.|...|..||  |:.::       .||              |.....
  Fly   562 -ENTSSATNGPHSN---STLPTPPPPPQAKHKAKKDPALDECNVHVKIADLGNACWVDRHFTEDI 622

  Fly   444 STTSSRNAGAIYVNGSHLSYD---TANMNAKNNAKFVVGASNGGY-YVPVARPS----------- 493
            .|...|:...|...|.:.|.|   ||.|        |...:.|.| :.|.:..|           
  Fly   623 QTRQYRSLEVIIGAGYNTSADIWSTACM--------VFELATGDYLFEPHSGESYTRDEDHLAHI 679

  Fly   494 --LLGPDAKVYNVFSKVSASQAPPSLIVRQPQLQPEVAPAPMRLSGRSRAAAAVQDPKM---GAL 553
              ||||                               .|..:.|:|...|.:..:..::   ..|
  Fly   680 IELLGP-------------------------------IPREILLNGTYAAKSFTRSCELRNISGL 713

  Fly   554 KSDDLDLILGSKLKTSAK-----------------RQRNAKANILLEDLFGQLSMDSDSDGKYPH 601
            |...|..:|..|.:.|.|                 .:|...|..|...   .|. |:...|.:..
  Fly   714 KPWGLMDVLLEKYEWSQKDAASFASFLTPMLEFDPNKRATAAECLQHP---WLRXDTMQPGCWLR 775

  Fly   602 -TVPPTQQAKSGKTSTGGHGAGARERDLF---GESYLPRPG------LRKKATQSSL-EVNNGSH 655
             |.|.|.....|..:..|.|.|.|.|...   |...:|..|      :...|:.::| .:::.:.
  Fly   776 ATQPATADGDGGALAGTGTGKGTRARATALKGGSPAVPADGEVGRGYIESSASVATLASISSIAS 840

  Fly   656 ADSLAPNAQKEKPAVASSF 674
            ..:.|..|.|.:|.:.:.|
  Fly   841 TSAAAMAALKARPYLVAPF 859

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42366NP_723501.2 STKc_MAK_like 4..284 CDD:270824 75/325 (23%)
S_TKc 4..284 CDD:214567 75/325 (23%)
SRPKNP_001260993.1 STKc_SRPK 159..>318 CDD:271038 49/152 (32%)
STKc_SRPK <600..763 CDD:271038 35/205 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C112998189
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24055
RoundUp 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.