DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42366 and pit1

DIOPT Version :8

Sequence 1:NP_723501.2 Gene:CG42366 / 34319 FlyBaseID:FBgn0259712 Length:706 Species:Drosophila melanogaster
Sequence 2:NP_593607.1 Gene:pit1 / 2543071 PomBaseID:SPAC3C7.06c Length:650 Species:Schizosaccharomyces pombe

Alignment Length:558 Identity:165/559 (30%)
Similarity:262/559 (47%) Gaps:100/559 (18%)


  Fly     4 YITLTQLGDGTYGTVVLGQRK-DTGEKVAIKRMKRKYYSWEEAMNLREVKSLKKLS-HPNIVKLK 66
            |..:.::||||:|:|.|...| .:.|.||||.||:|.....:|..||||.||.:|| :.|||.:.
pombe    36 YNVVRKVGDGTFGSVYLATTKTPSKEVVAIKSMKKKLAKVSDATRLREVHSLLRLSENENIVNIF 100

  Fly    67 EV-IRENDTLYFVFEYMKENLYQMIKDR-DTHLPEPELKSILFQVLTGLAFMHRHGFFHRDLKPE 129
            :: |.:...|:.|.|::..||||:|..| :..|...:::.|:.|:..||..:|.:||||||:|||
pombe   101 DLYIDQFRCLHIVMEFLDCNLYQLISTRKNDPLTLEQVQDIMRQIFKGLNHIHTNGFFHRDMKPE 165

  Fly   130 NLLCSGPD-----LIKIADFGLAREIRSRPPFTDYVSTRWYRAPEVLLHSTNYGSTIDLWAMGCI 189
            |:|.|...     .:|||||||||||.||||:|:|||||||||||:||..:.|...:|::|.||:
pombe   166 NILISSNSDSSSFNVKIADFGLAREINSRPPYTEYVSTRWYRAPELLLRDSYYSFPVDIYAAGCM 230

  Fly   190 MAELYTFRPLFPGSSEVDQLFKICSVLGTPDKDD----------WPDGYRLASMIHFRYP----- 239
            ..|:.|.:|:|||:.:.|||:|:|.:||:||:..          |.....||:.:....|     
pombe   231 AFEIATLQPIFPGNDDFDQLYKMCEILGSPDEQSQNTGDKGGGIWDRAELLANKLGISLPKMAPL 295

  Fly   240 ---DCIKVPLSSVVSRCSQNGLDLLEDMLAYDPDKRPTAQQSLKYPYFHALKRISPTA---ATKA 298
               |....|.:...:       .:|..:|.:||.|||||:..|...:.    |:|..|   |:|.
pombe   296 DFGDLFSPPWNLAFA-------SMLSQLLKWDPAKRPTAEMCLDLEFC----RVSAPADAVASKE 349

  Fly   299 NVRLNSKYAASNGH-PVQSVSNNVLPVQEKLQ---AVTELLHQTNNNMNSHSNLGKNNNLAPKNG 359
            .|..|:.:..|..: |..|...:....:|:.:   :.::.|.|.|...|..:...:.:....|| 
pombe   350 EVNKNTDFRVSISYFPSSSSIPDECNTEEESRINPSTSKFLKQLNKGFNGFTKPFRKSRKQSKN- 413

  Fly   360 GVPRKYQPKLS--FLTTSEMGAGSHADSS-------------------SLVGGATVDGV------ 397
               ||.:..::  |...||..|.|...|:                   :.:..::.|..      
pombe   414 ---RKNKSSVATQFSEESEDIADSITSSTFFPVLPQIRPSTPLNLKLRNFIISSSEDSTSPKAKE 475

  Fly   398 ---PV--------------------PQHQNGGESIN-DIYLNRNISQLFGLPAGPQHQQQQQVHH 438
               |:                    |..::|...:: ...|:..||....:.:....::.|.|:.
pombe   476 FDRPLPSTEFLVAINKSQEALLNNSPNSKSGSTQLSASTCLSDLISPQLSILSHEDKRENQSVNS 540

  Fly   439 PNVSFSTTSSRNAGAIYVNGSHLSYDTANMNAKNNAKF 476
            .:..:|..||.::..::....|....|.|..||:...|
pombe   541 ESSKYSPRSSNHSPTLHSKDLHRDMATVNNYAKSPPSF 578

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42366NP_723501.2 STKc_MAK_like 4..284 CDD:270824 122/307 (40%)
S_TKc 4..284 CDD:214567 122/307 (40%)
pit1NP_593607.1 S_TKc 36..335 CDD:214567 122/306 (40%)
STKc_MAK_like 36..332 CDD:270824 122/303 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 213 1.000 Inparanoid score I924
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001283
OrthoInspector 1 1.000 T631717
orthoMCL 1 0.900 OOG5_127559
Panther 1 1.100 LDO PTHR24055
Phylome 1 0.910 0.811 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.