DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42366 and ICK

DIOPT Version :8

Sequence 1:NP_723501.2 Gene:CG42366 / 34319 FlyBaseID:FBgn0259712 Length:706 Species:Drosophila melanogaster
Sequence 2:XP_011512721.1 Gene:ICK / 22858 HGNCID:21219 Length:639 Species:Homo sapiens

Alignment Length:631 Identity:257/632 (41%)
Similarity:351/632 (56%) Gaps:112/632 (18%)


  Fly     1 MNRYITLTQLGDGTYGTVVLGQRKDTGEKVAIKRMKRKYYSWEEAMNLREVKSLKKLSHPNIVKL 65
            ||||.|:.||||||||:|:||:..::||.:|||:||||:|||||.||||||||||||:|.|:|||
Human     1 MNRYTTIRQLGDGTYGSVLLGRSIESGELIAIKKMKRKFYSWEECMNLREVKSLKKLNHANVVKL 65

  Fly    66 KEVIRENDTLYFVFEYMKENLYQMIKDRDTHLPEPELKSILFQVLTGLAFMHRHGFFHRDLKPEN 130
            ||||||||.|||:||||||||||:||:|:...||..:::|::|:|.||||:|:||||||||||||
Human    66 KEVIRENDHLYFIFEYMKENLYQLIKERNKLFPESAIRNIMYQILQGLAFIHKHGFFHRDLKPEN 130

  Fly   131 LLCSGPDLIKIADFGLAREIRSRPPFTDYVSTRWYRAPEVLLHSTNYGSTIDLWAMGCIMAELYT 195
            |||.||:|:|||||||||||||:||:||||||||||||||||.||||.|.||:||:||||||:||
Human   131 LLCMGPELVKIADFGLAREIRSKPPYTDYVSTRWYRAPEVLLRSTNYSSPIDVWAVGCIMAEVYT 195

  Fly   196 FRPLFPGSSEVDQLFKICSVLGTPDKDDWPDGYRLASMIHFRYPDCIKVPLSSVVSRCSQNGLDL 260
            .||||||:||:|.:||||.|||||.|.|||:||:|:|.::||:|.|:...|.:::...|...:.|
Human   196 LRPLFPGASEIDTIFKICQVLGTPKKTDWPEGYQLSSAMNFRWPQCVPNNLKTLIPNASSEAVQL 260

  Fly   261 LEDMLAYDPDKRPTAQQSLKYPYFHA------------------------------LKRISPT-A 294
            |.|||.:||.|||||.|:|:||||..                              :|.:.|. .
Human   261 LRDMLQWDPKKRPTASQALRYPYFQVGHPLGSTTQNLQDSEKPQKGILEKAGPPPYIKPVPPAQP 325

  Fly   295 ATKANVRLNSKYAASNGHPVQ-------SVSNNVLPVQEKLQAVTELLHQTNNNMNSHSNLGKNN 352
            ..|.:.|::|:...::..|:.       .||....|...:....:.||..:.:|.:..|....::
Human   326 PAKPHTRISSRQHQASQPPLHLTYPYKAEVSRTDHPSHLQEDKPSPLLFPSLHNKHPQSVSSPDS 390

  Fly   353 -----NLAPKNGGVPRKYQPKLSFLTTSEMGAGSHADSSSLVGGATVDGVPVPQHQNGG------ 406
                 .|..|||.:..|.:.:...::.|...:...||...|....::..:.:...:...      
Human   391 PKITAGLEHKNGEIKPKSRRRWGLISRSTKDSDDWADLDDLDFSPSLSRIDLKNKKRQSDDTLCR 455

  Fly   407 -ESINDI-----------------YLNRNISQLFGLPAGPQHQQQQQVHHPNVSFSTTSSRNAGA 453
             ||:.|:                 |..|:...|  ..|..||..:...:.|.:|.......|.|.
Human   456 FESVLDLKPSEPVGTGNSAPTQTSYQRRDTPTL--RSAAKQHYLKHSRYLPGISIRNGILSNPGK 518

  Fly   454 IYV-------NG-SHLSYDTANMNAKNNAKFVVGASN------GGYYVPVARPSLLG-------- 496
            .::       :| |..|..|.::.:|.|:   ||:|:      .|.|||......:|        
Human   519 EFIPPNPWSSSGLSGKSSGTMSVISKVNS---VGSSSTSSSGLTGNYVPSFLKKEIGSAMQRVHL 580

  Fly   497 ---PDAKVYNVFSKVSA-------------SQAPPSLIVRQPQLQP 526
               ||..  ..:|.:.|             .::.|.||.|.|..||
Human   581 APIPDPS--PGYSSLKAMRPHPGRPFFHTQPRSTPGLIPRPPAAQP 624

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG42366NP_723501.2 STKc_MAK_like 4..284 CDD:270824 193/280 (69%)
S_TKc 4..284 CDD:214567 193/280 (69%)
ICKXP_011512721.1 STKc_MAK_like 4..284 CDD:270824 193/280 (69%)
S_TKc 4..284 CDD:214567 193/280 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0661
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S1479
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001283
OrthoInspector 1 1.000 T609884
orthoMCL 1 0.900 OOG5_127559
Panther 1 1.100 O PTHR24055
Phylome 1 0.910 0.933 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3024
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.