DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4598 and Echs1

DIOPT Version :10

Sequence 1:NP_609322.1 Gene:CG4598 / 34315 FlyBaseID:FBgn0032160 Length:281 Species:Drosophila melanogaster
Sequence 2:XP_320683.3 Gene:Echs1 / 1280816 VectorBaseID:AGAMI1_011736 Length:299 Species:Anopheles gambiae


Alignment Length:103 Identity:22/103 - (21%)
Similarity:38/103 - (36%) Gaps:24/103 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   482 LTEFWDGRNQESTSEAVNAYYSAALLGLAYGDKH------------LVETASTIMTLEIHAAKMW 534
            |.:|:|..|....::...:.....|.||::...|            |:.|..|:...:...|:.:
Mosquito    87 LKKFFDSLNGYMDAQTARSLMLQLLRGLSFCHAHHVLHRDLKPQNLLINTNGTLKLADFGLARAF 151

  Fly   535 WQVKKGEALYPKDFTAENRVVGVLWSTKRDSSLWFGPK 572
                   .:..:.|:||   |..||  .|...:.||.|
Mosquito   152 -------GVPVRCFSAE---VVTLW--YRPPDVLFGAK 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4598NP_609322.1 crotonase-like 27..217 CDD:119339
Echs1XP_320683.3 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.