DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha6 and HisCl1

DIOPT Version :8

Sequence 1:NP_995675.1 Gene:nAChRalpha6 / 34304 FlyBaseID:FBgn0032151 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_731632.1 Gene:HisCl1 / 41426 FlyBaseID:FBgn0037950 Length:426 Species:Drosophila melanogaster

Alignment Length:355 Identity:85/356 (24%)
Similarity:150/356 (42%) Gaps:53/356 (15%)


  Fly     1 MDSP---LPASLSLFVLLIFLAIIKESCQGPH----------EKRLLNHLLSTYNTLE-RPVANE 51
            |.||   |.....|..|.|:|..:::|.|..|          ...|::|..|:.:..: .|:.::
  Fly     1 MQSPTSKLVEFRCLIALAIYLHALEQSIQHCHCVHGYRNNTESAELVSHYESSLSLPDILPIPSK 65

  Fly    52 S-----------EPLEVKFGLTLQQIIDVDEKNQILTTNAWLNLEWNDYNLRW--NETEYGGVKD 103
            :           :|..|.|.:|:..:..::|::....|:.:|...|.|..||.  |.:|...:.|
  Fly    66 TYDKNRAPKLLGQPTVVYFHVTVLSLDSINEESMTYVTDIFLAQSWRDPRLRLPENMSEQYRILD 130

  Fly   104 LRITPNKLWKPDVLMYNSADEGFDGTYHTNIV------VKHNGSCLYVPPGIFKSTCKIDITWFP 162
            :... :.:|:||....|:...    |:|...:      :.|:.:.||:.......:|.:....:|
  Fly   131 VDWL-HSIWRPDCFFKNAKKV----TFHEMSIPNHYLWLYHDKTLLYMSKLTLVLSCAMKFESYP 190

  Fly   163 FDDQHCEMKFGSWTYDGNQLDLVLNSEDGGDLSDFITNGEWYLLAMPGKKN-----TIVYACCPE 222
            .|.|.|.|...|.::....|..:.|..|     ..:.|.|..|..:....|     ||.|:  ..
  Fly   191 HDTQICSMMIESLSHTVEDLVFIWNMTD-----PLVVNTEIELPQLDISNNYTTDCTIEYS--TG 248

  Fly   223 PYVDITFTIQIRRRTLYYFFNLIVPCVLISSMALLGFTLPPDS-GEKLTLGVTILLSLTVFLNLV 286
            .:..:.....:|||..|:.|:..:|..||..|:.:.|.:.|:: ..::|||||.||:|.......
  Fly   249 NFTCLAIVFNLRRRLGYHLFHTYIPSALIVVMSWISFWIKPEAIPARVTLGVTSLLTLATQNTQS 313

  Fly   287 AESMPTTSDAVPLIGVTI-LLSLTVFLNLV 315
            .:|:|..| .|..|.|.: ..|:.|||:|:
  Fly   314 QQSLPPVS-YVKAIDVWMSSCSVFVFLSLM 342

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nAChRalpha6NP_995675.1 LIC 11..517 CDD:273305 81/343 (24%)
Neur_chan_LBD 30..237 CDD:280998 47/232 (20%)
Neur_chan_memb 244..511 CDD:280999 25/75 (33%)
HisCl1NP_731632.1 Neur_chan_LBD 67..262 CDD:280998 42/207 (20%)
Neur_chan_memb 270..>350 CDD:280999 25/75 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR18945
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.