DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha6 and CG12344

DIOPT Version :8

Sequence 1:NP_995675.1 Gene:nAChRalpha6 / 34304 FlyBaseID:FBgn0032151 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_001286298.1 Gene:CG12344 / 36145 FlyBaseID:FBgn0033558 Length:449 Species:Drosophila melanogaster

Alignment Length:362 Identity:71/363 (20%)
Similarity:124/363 (34%) Gaps:105/363 (29%)


  Fly    46 RPVANESEPLEVKFGLTLQQIIDVDEKNQILTTNAWLNLEWNDYNL------RWNETEYGGVKDL 104
            ||.:.:..|:.|.|.:.   ::|::.          :|:|..|:.:      ||.|:......|:
  Fly    49 RPPSKKGSPVIVDFSIF---VVDINS----------INVEDMDFRVDMFIHQRWLESRLEIPDDI 100

  Fly   105 --------RITP---NKLWKPDVLMYNSADEGFDGTYH--TNIVVKHNGSCLYVPPGIFKSTCKI 156
                    .:.|   ...|:||....||.........|  |::.:..|.:..|.........|::
  Fly   101 FEEGDDYVTLLPEVFENFWQPDPYFLNSKIAEIATLTHKFTSVTLYKNKTVRYAARMHAIIACQM 165

  Fly   157 DITWFPFDDQHCEMKFGSWTYDGNQLDLVLNSEDGGDLSDFIT-NGEWYLLA------------- 207
            :...:|.|.|.|.:...|  :..|...:.|...|.|     :| |.|..||.             
  Fly   166 EFQLYPMDIQVCPIYIES--FSSNNQKVKLRWSDSG-----VTLNPELKLLQYNLGQPLELEESD 223

  Fly   208 --MPGKKNTIVYACCPEPYVDITFTIQIRRRTLYYFFNLIVPCVLISSMALLGFTLPPDS-GEKL 269
              ||.|...         :..:|...:..|:..::......|..|:..::...|.|..|: ..::
  Fly   224 GYMPEKVGN---------FSRLTVYFRFERQIGHHLIQTFAPSSLVVMLSWFSFWLGLDAIPGRV 279

  Fly   270 TLGVTILLSLTVFLNLVAESMPTTSDAVPLIGVTIL------LSLTVFLNLVAETLPQVSDAIPL 328
            ||.||.:|:|.        :|.|.:|..|:..|..|      ..|:||..|              
  Fly   280 TLLVTCMLTLV--------TMFTGADIPPVAYVKALDLWMAGCMLSVFAAL-------------- 322

  Fly   329 LGTYFNCIMFMVASSVVLTVVVLNYHHRTADIHEMPP 365
                        |..||:.|:.:.|.::...|.::.|
  Fly   323 ------------AEFVVVKVLDVQYQYQVNRIPKVLP 347

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nAChRalpha6NP_995675.1 LIC 11..517 CDD:273305 71/363 (20%)
Neur_chan_LBD 30..237 CDD:280998 43/226 (19%)
Neur_chan_memb 244..511 CDD:280999 28/130 (22%)
CG12344NP_001286298.1 Neur_chan_LBD 8..441 CDD:332142 71/363 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR18945
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.