DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nAChRalpha6 and lgc-30

DIOPT Version :8

Sequence 1:NP_995675.1 Gene:nAChRalpha6 / 34304 FlyBaseID:FBgn0032151 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_500015.3 Gene:lgc-30 / 186551 WormBaseID:WBGene00019069 Length:529 Species:Caenorhabditis elegans

Alignment Length:506 Identity:118/507 (23%)
Similarity:209/507 (41%) Gaps:103/507 (20%)


  Fly    47 PVANESEPLEVKFGLTLQQIIDVDEKNQILTTNAWLNLEWNDYNLRWNETEYGGVKDLRITPNKL 111
            |:.:....::|.....|.||:|:|::|.:.|.:|:|::.|||..::|....:||::.:.:....:
 Worm    82 PLKHPHTRIDVFISAGLYQIVDLDQRNNLATVSAYLDVHWNDDFIKWKPEIFGGIERIFVPIKWI 146

  Fly   112 WKPDVLMYNSA-----DEGFDGT--YHTNIVVKHNGSCLYVPPGIFKSTCKIDITWFPFDDQHCE 169
            |||:..||:|.     |...|.:  .|.|.:|:     ::|... .||.|.|:...||||.|.|.
 Worm   147 WKPEFYMYHSVYGRVPDYAPDASAELHYNGLVR-----MFVSIS-SKSFCPINFKRFPFDSQTCS 205

  Fly   170 MKFGSWTYDGNQLDLVLNSEDGGDLSDFITNGEWYLL-AMPGKKNTIVYACCPEPYVDITFTIQI 233
            ...|||.|..|.::||...::.. |.||..|.||.|. |......|...:...|.:..:...:.:
 Worm   206 FSCGSWAYQSNIVNLVAAKQEIA-LEDFYDNQEWLLTDARLFNGTTRNVSAANESFSMVYMQLDL 269

  Fly   234 RRRTLYYFFNLIVPCVLISSMALLGFTLPPDS----GEKLTLGVTILLSLTVFLNLVAESMPTTS 294
            :|::.||.|||:.|..|:|.:|::||..|.::    ..|..||:..|||::|.|.::...|....
 Worm   270 KRQSFYYVFNLVFPTTLVSLVAVIGFHAPINATGRRESKFRLGIMTLLSMSVMLLMLVGEMKFAM 334

  Fly   295 DAVPLIGVTILLSLTVFLNLVAETLPQVSDAIPLLGTYFN---CIMFMVASSVVLTVVVLNYHHR 356
            ::||                  ......|| :||:|.|:.   ||:.:...:..:.|.:..:..|
 Worm   335 ESVP------------------GQRGSFSD-VPLMGIYYMTLICIVSIATCTSSIFVHLEKFALR 380

  Fly   357 TADIHEMPPWI-----KSVFLQWLPWILRMGR-----------------PGRKITRKTILLSNRM 399
            ......:|.:|     |.:|..::|...|..:                 |.|.:.:..|     .
 Worm   381 NPSWQSVPWYIRWLAAKKLFCCYVPKSFRYDKDAYSRNNNVQAISLHSTPDRNVAKNLI-----P 440

  Fly   400 KELELKERSSKSLLANVLDIDDDFRHTISGSQTAIGSSASFGRPTTVEEHHTAIGCNHKDLHLIL 464
            ||:...|.:..:.|.:||:                |.||.                ..:.:.||:
 Worm   441 KEINFTEVNQDAPLHDVLE----------------GPSAE----------------KTQKIDLIV 473

  Fly   465 KELQFITARMRKADDEAELIGDWKFAAMVVDRFCLIVFTLFTIIATVTVLL 515
            ..|:.|.....:.....:|...|.   .::.|...:..:.:..:.|:.||:
 Worm   474 SLLREIIHLKERIGASGQLAPYWD---QIISRCEKVSLSFYLFLITINVLM 521

Known Domains:


GeneSequenceDomainRegion External IDIdentity
nAChRalpha6NP_995675.1 LIC 11..517 CDD:273305 118/507 (23%)
Neur_chan_LBD 30..237 CDD:280998 57/198 (29%)
Neur_chan_memb 244..511 CDD:280999 55/296 (19%)
lgc-30NP_500015.3 Neur_chan_LBD 68..272 CDD:280998 57/197 (29%)
Neur_chan_memb 280..>399 CDD:280999 32/138 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18945
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.