DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13123 and Ovol3

DIOPT Version :10

Sequence 1:NP_609315.1 Gene:CG13123 / 34303 FlyBaseID:FBgn0032150 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001276749.1 Gene:Ovol3 / 365226 RGDID:1583800 Length:190 Species:Rattus norvegicus


Alignment Length:104 Identity:33/104 - (31%)
Similarity:44/104 - (42%) Gaps:16/104 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 PSGSQAIYKCQYCPLAYASPQYLKTHVR-----NSHVCKYCTTAFAKVRDLNEHIRQKHPH---- 274
            |.|...: .|..||.|:...:.|..|::     ..|||.||...|....||..|:|   .|    
  Rat    63 PKGPGTL-SCPLCPKAFPLQRMLTRHLKCHSPARRHVCHYCGKGFHDAFDLKRHMR---THTGIR 123

  Fly   275 -HQCVVCSNNFSTSSNLRAHLKKIHGVQLPAQVALLDYR 312
             .:|..|...|:...:|.|||.|:||  .||..|..:.|
  Rat   124 PFRCGACGKAFTQRCSLEAHLAKVHG--QPASYAYRERR 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13123NP_609315.1 zf-AD 6..82 CDD:471776
PHA00733 175..272 CDD:177301 18/57 (32%)
C2H2 Zn finger 228..245 CDD:275368 5/16 (31%)
C2H2 Zn finger 251..272 CDD:275368 8/20 (40%)
KREPA <269..>303 CDD:483960 12/38 (32%)
C2H2 Zn finger 277..298 CDD:275368 8/20 (40%)
Ovol3NP_001276749.1 COG5048 <19..>127 CDD:227381 19/67 (28%)
C2H2 Zn finger 71..91 CDD:275368 6/19 (32%)
zf-C2H2 97..119 CDD:395048 10/24 (42%)
C2H2 Zn finger 99..119 CDD:275368 8/22 (36%)
zf-H2C2_2 111..136 CDD:463886 8/27 (30%)
C2H2 Zn finger 127..148 CDD:275368 8/20 (40%)
C2H2 Zn finger 166..186 CDD:275368
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.