DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13123 and ovo

DIOPT Version :10

Sequence 1:NP_609315.1 Gene:CG13123 / 34303 FlyBaseID:FBgn0032150 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_726971.1 Gene:ovo / 31429 FlyBaseID:FBgn0003028 Length:1351 Species:Drosophila melanogaster


Alignment Length:86 Identity:21/86 - (24%)
Similarity:40/86 - (46%) Gaps:13/86 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 YKCQYCPLAYASPQYLKTHVR-----NSHVCKYCTTAFAKVRDLNEHIRQKHPH-----HQCVVC 280
            :.|:.|...::..:.|..|::     ..::|.:|...|....||..|.|   .|     ::|.:|
  Fly  1197 FVCRVCMKTFSLQRLLNRHMKCHSDIKRYLCTFCGKGFNDTFDLKRHTR---THTGVRPYKCNLC 1258

  Fly   281 SNNFSTSSNLRAHLKKIHGVQ 301
            ..:|:...:|.:|.:|:|.||
  Fly  1259 EKSFTQRCSLESHCQKVHSVQ 1279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13123NP_609315.1 zf-AD 6..82 CDD:471776
PHA00733 175..272 CDD:177301 11/50 (22%)
C2H2 Zn finger 228..245 CDD:275368 3/16 (19%)
C2H2 Zn finger 251..272 CDD:275368 7/20 (35%)
KREPA <269..>303 CDD:483960 11/38 (29%)
C2H2 Zn finger 277..298 CDD:275368 6/20 (30%)
ovoNP_726971.1 C2H2 Zn finger 1199..1219 CDD:275368 4/19 (21%)
zf-H2C2_2 1212..1235 CDD:463886 4/22 (18%)
C2H2 Zn finger 1227..1247 CDD:275368 7/22 (32%)
zf-H2C2_2 1239..1264 CDD:463886 8/27 (30%)
C2H2 Zn finger 1255..1276 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.