DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17633 and Cpo

Sequence 1:NP_609310.2 Gene:CG17633 FlyBaseID:FBgn0032144 Length:430 Species:Drosophila melanogaster
Sequence 2:XP_017452387.1 Gene:Cpo RGDID:1588771 Length:355 Species:Rattus norvegicus

Alignment Length:350 Identity:82/350 (23%)
Similarity:145/350 (41%) Gaps:74/350 (21%)


  Fly   115 RATTAYNWAQYYELD-DTYAWLQSLAQTNPGVVTLIEGGKTYQGRSILGVKITKGGETINGKAKP 178
            |:...|::.:|:... ..|.|::.:::....|:|......||:...:..:|.:......:..:|.
  Rat    15 RSLETYSYDRYHPWGRGIYQWMRQVSEKYAEVLTQHFLRMTYETWPMHYLKESAEISLTSSNSKK 79

  Fly   179 GIFLEAGIHAREWIAPAAATFIINQ--------LLTSEVENIKELAENYTWY---------VLP- 225
            .|:::.||||..|||||...:.:.:        :|...:|.:..|..:.|::         :.| 
  Rat    80 TIWIDCGIHASRWIAPAFCQWFLREGSVFTCLLMLNHAIEYLSTLGSSETYFFPVNWNGIQLAPL 144

  Fly   226 --HA------------------------------NPDGYVYTHTTNRLWRKTRTPYGS---CFGA 255
              |:                              |.|| :||.||  .|   ..|.|.   |...
  Rat   145 QNHSRHFSNFQILQNDKDSARIGRLLKELDFXVLNADGXIYTWTT--AW---TLPVGQGYLCLRT 204

  Fly   256 D------PNRNWG-FHWNEVGASSSACSD-TYAGPSAFSEIETLSLSKFIEGLKGK--VQLYLSL 310
            |      |....| .::.::|...: |.| |:.|.....|.| |:.|:.::..:||  :..:|.:
  Rat   205 DSFLCYQPFYFQGLLYFPDIGTPIN-CQDVTFCGIEPMLEPE-LTPSQALQKARGKKDILCFLIM 267

  Fly   311 HAYSQYLLYPYGHTSDLPDNVADFEKVFDASIAAVNKRYGTTYTGGNIYDAIYPAAGASVDWAYG 375
            .:|.|.:|.|||||.:.|.|..:..:|...:..|:..::||.|..|:..|.:|..:|:|.||..|
  Rat   268 GSYGQLILTPYGHTKNKPHNYEELIQVGQKAARALKAKHGTNYRVGSGADILYMLSGSSKDWNGG 332

  Fly   376 TQDVRMAFCYELRPSSTSYLTGFKL 400
            ......::.:||..:.|.   ||.|
  Rat   333 IGIPLFSYTFELVDNGTH---GFAL 354

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17633NP_609310.2 MpaA 7..374 CDD:225421 75/323 (23%)
Propep_M14 34..105 CDD:280416
M14_CP_A-B_like 125..423 CDD:199844 80/340 (24%)
CpoXP_017452387.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.