DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17633 and CG18585

Sequence 1:NP_609310.2 Gene:CG17633 FlyBaseID:FBgn0032144 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001260213.1 Gene:CG18585 FlyBaseID:FBgn0031929 Length:422 Species:Drosophila melanogaster

Alignment Length:431 Identity:164/432 (38%)
Similarity:248/432 (57%) Gaps:25/432 (6%)


  Fly     8 LFALLAIVASASV--SAERVRYDNYRMYKVNSENAKQLEVLKDLEGSSDSIMFLDGVHLVGADIQ 70
            |.|.|..:.||.:  .:.:.||||:|:||:..:|..||..::.:...:...............|.
  Fly     6 LLATLVALTSAGILKDSPKERYDNFRVYKLTIQNKIQLAAIEKIGELTKKYNIWKEYDERSRQID 70

  Fly    71 IIVAPHKVPDFLEILGKSEIKYELQSRDVQKSLDEIDEKVAIKGRATTAYNWAQYYELDDTYAWL 135
            |:|:|.::..|.|:|..:.|..||...:||:.:||  |:|.....:.| :.|.:||||::..|||
  Fly    71 IMVSPGELNHFQELLKFNNISSELMIENVQERIDE--EQVTPTADSAT-FGWTKYYELEEIEAWL 132

  Fly   136 QSLAQTNPGVVTLIEGGKTYQGRSILGVKIT-KGGETINGKAKPGIFLEAGIHAREWIAPAAATF 199
            ..:....|.|......||:|:||:|.|:||: |.|       .||||:|:.|||||||..|:||:
  Fly   133 DEILNAYPSVTEEFIVGKSYEGRTIRGIKISHKAG-------NPGIFIESNIHAREWITSASATW 190

  Fly   200 IINQLLTSEVENIKELAENYTWYVLPHANPDGYVYTHTTNRLWRKTRTPY--GSCFGADPNRNWG 262
            .||||||||..:::.||:||.|:::|..|.||:.|:|..:|:|||||.|:  .:|.|||.|||:.
  Fly   191 FINQLLTSEDADVRSLADNYDWHIIPVFNVDGFEYSHKKDRMWRKTRQPHATNACIGADANRNFD 255

  Fly   263 FHW-NEVGASSSACSDTYAGPSAFSEIETLSLSKFIEGLKGKVQLYLSLHAYSQYLLYPYGHTS- 325
            .:| ...|||.:.||:|:||.:..||.|..:|.:::..::.::.:|:|.|:|.||||.|||||: 
  Fly   256 SYWLQNNGASDNPCSETFAGDNPESEPEAKALVEYLTKIQDQISVYISFHSYGQYLLSPYGHTNE 320

  Fly   326 DLPDNVAD---FEKVFDASIAAVNKRYGTTYTGGNIYDAIYPAAGASVDWAYGTQDVRMAFCYEL 387
            :.|:|..|   ..|.|..:|.|:  .|||.|..|:..|.:|.|.|.||||.:.....::.:..|.
  Fly   321 EFPENYNDILTIGKAFADAIEAL--PYGTVYQYGSTADVLYVATGTSVDWVFNELGKKIGYTIEY 383

  Fly   388 RPSSTSYLTGFKLPAEQIVPASEELLDSIVAMATEVKSLGY 428
            |....   .||.||..||:|..|||:..::|:..:.|.|||
  Fly   384 RDKGR---YGFILPPVQIIPNCEELMVGMLALIEKTKELGY 421

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17633NP_609310.2 MpaA 7..374 CDD:225421 147/376 (39%)
Propep_M14 34..105 CDD:280416 17/71 (24%)
M14_CP_A-B_like 125..423 CDD:199844 127/306 (42%)
CG18585NP_001260213.1 Propep_M14 34..105 CDD:280416 17/71 (24%)
M14_CP_A-B_like 122..415 CDD:199844 127/305 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C71061241
eggNOG 1 0.900 E1_COG2866
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I2432
Isobase 1 0.950 0 Normalized mean entropy S1851
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
orthoMCL 1 0.900 OOG5_132369
Panther 1 1.100 P PTHR11705
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1730
98.870

Return to query results.
Submit another query.