DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17633 and T06A4.1

Sequence 1:NP_609310.2 Gene:CG17633 FlyBaseID:FBgn0032144 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_871809.1 Gene:T06A4.1 WormBaseID:WBGene00020281 Length:606 Species:Caenorhabditis elegans

Alignment Length:447 Identity:147/448 (33%)
Similarity:234/448 (52%) Gaps:36/448 (8%)


  Fly     1 MSLNKCLLF--ALLAIVASASVSAERVRYDNYRMYKVNSENAKQLEVLKDL--EGSSDSIMFLDG 61
            |.|...||.  |....:.:...:.:...|.|:::.::|.|....::.|:.|  :.|...:.|...
 Worm     1 MRLPSILLIFGAFFGFLGAIHNTDDNAGYHNFKLIRINPETEGSVKYLRSLYEDPSPYELDFWQP 65

  Fly    62 VHLVGADIQIIVAPHKVPDFLEILGKSEIKYELQSRDVQKSLDEIDEKVAIK-GRATTAYNWAQY 125
            ...:||.:.:.|||...|.|::.|...:|.|.:...|:.|:::  :|:.:.| ......:.:.:|
 Worm    66 PTNIGAIVDLTVAPADAPRFVKDLESKKISYIVAVNDLSKAIE--NERGSDKFYNPVAGFAYDKY 128

  Fly   126 YELDDTYAWLQSLAQTNPGVVTLIEGGKTYQGRSILGVKITKGGETINGKAKP-----GIFLEAG 185
            ..|::....::.|.:..|.::|||:.|::::.|::|.:|||       ||..|     .::::||
 Worm   129 NSLEEIQTEMKRLKKEYPTMITLIDIGQSHENRTLLVMKIT-------GKRNPLGSKISMWIDAG 186

  Fly   186 IHAREWIAPAAATFIINQLLTSEVEN---IKELAENYTWYVLPHANPDGYVYTHTTNRLWRKTRT 247
            ||||||||||.|.:|.::||.. .||   :.:|.::..:|:||..|||||.|:...||:|||.|:
 Worm   187 IHAREWIAPATAMYIAHELLLG-YENDATVAKLMDHIDFYILPVMNPDGYEYSREKNRMWRKNRS 250

  Fly   248 PYG---------SCFGADPNRNWGFHWNEVGASSSACSDTYAGPSAFSEIETLSLSKFIEGLKGK 303
            |..         .|.|.|.|||:.:.|...|:||..|.|||.|.:||||.|:.::..|:|  :..
 Worm   251 PAKCARQTFSTVCCSGVDLNRNFDWFWASTGSSSDPCHDTYHGSAAFSEPESQAVRDFLE--QNT 313

  Fly   304 VQLYLSLHAYSQYLLYPYGH--TSDLPDNVADFEKVFDASIAAVNKRYGTTYTGGNIYDAIYPAA 366
            .:.::|||:|||..|.||||  .|...|.......:...:..|:.:.|||.|..|...|.:|.|:
 Worm   314 PEAFISLHSYSQMWLIPYGHRKQSYPQDYHTGLRPLALRATKALYELYGTKYQVGTGADLMYEAS 378

  Fly   367 GASVDWAYGTQDVRMAFCYELRPSSTSYLTGFKLPAEQIVPASEELLDSIVAMATEV 423
            |.|.|||.|...|..|:..||||.:|....||.||..:|||...|..:||..:|.|:
 Worm   379 GGSHDWAKGQLKVPYAYLIELRPKNTMMGHGFLLPEREIVPTGLETFESIKVVADEL 435

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17633NP_609310.2 MpaA 7..374 CDD:225421 125/391 (32%)
Propep_M14 34..105 CDD:280416 18/73 (25%)
M14_CP_A-B_like 125..423 CDD:199844 120/317 (38%)
T06A4.1NP_871809.1 Propep_M14 36..109 CDD:280416 18/75 (24%)
M14_CP_A-B_like 128..435 CDD:199844 120/317 (38%)
ShK 568..602 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C71187410
eggNOG 1 0.900 E1_COG2866
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 239 1.000 Inparanoid score I2086
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1730
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.