DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17633 and LOC100489361

Sequence 1:NP_609310.2 Gene:CG17633 FlyBaseID:FBgn0032144 Length:430 Species:Drosophila melanogaster
Sequence 2:XP_017952843.1 Gene:LOC100489361 ID: Length:422 Species:Xenopus tropicalis

Alignment Length:364 Identity:119/365 (33%)
Similarity:206/365 (56%) Gaps:23/365 (6%)


  Fly    66 GADIQIIVAPHKVPDFLEILGKSEIKYELQSRDVQKSLDE---ID---EKVAIKGRATTAYNWAQ 124
            |.::.:.|....:.:..|.|.::.:.|::...|||:.::.   |:   :|:::..     |::.:
 Frog    35 GREMHVRVPFSHLQEIKEKLLQNMLPYQILISDVQELVNRNTPIETKMQKISLDN-----YDYTK 94

  Fly   125 YYELDDTYAWLQSLAQTNPGVVTLIEGGKTYQGRSILGVKITKGGETINGKAKPGIFLEAGIHAR 189
            |:.:|:.|.|::.:...:..:||....|.||:.|.|...||....:    |.|..||::.|||||
 Frog    95 YHPMDEIYDWMEQIQLKHRDLVTKHFMGSTYELRPIYYFKIGWPSD----KPKKIIFMDCGIHAR 155

  Fly   190 EWIAPAAATFIINQLLTSEVEN--IKELAENYTWYVLPHANPDGYVYTHTTNRLWRKTRTPY--G 250
            ||||.|...:.:.::|:|...|  :..:.:...:||:|..|.|||:|:.||.|||||.|:|:  .
 Frog   156 EWIAVAYCQWFVKEILSSHSNNKLLTNVLKQVDFYVVPVFNIDGYIYSWTTERLWRKNRSPHNNA 220

  Fly   251 SCFGADPNRNWGFHWNEVGASSSACSDTYAGPSAFSEIETLSLSKFIEGLKGKVQLYLSLHAYSQ 315
            :|:|.|.|||:...|..||||....|.|:.|.:..||.||.:::..:|..|.::..||::|:|.|
 Frog   221 TCYGVDLNRNFNSSWCSVGASRDCNSQTFCGSAPASEPETQAVANLMERTKSQILFYLTIHSYGQ 285

  Fly   316 YLLYPYGHTSDLPDNVADFEKVFDASIAAVNKRYGTTYTGGNIYDAIYPAAGASVDWAYGTQDVR 380
            |:|.|||.|::...|..:..||.:|:.|.:.:::...||.|:....:|..:|:|.||| |...::
 Frog   286 YILLPYGSTTNPSVNHVEMTKVAEAAAAKMKEKHNIVYTVGSSSVVLYENSGSSCDWA-GDIGIK 349

  Fly   381 MAFCYELRPSSTSYLTGFKLPAEQIVPASEELLDSIVAM 419
            .::.:|||.:.|   .||:||||.|.|..||.:.::::|
 Frog   350 FSYTFELRDNGT---YGFQLPAELIKPTCEETMTAVISM 385

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17633NP_609310.2 MpaA 7..374 CDD:225421 103/318 (32%)
Propep_M14 34..105 CDD:280416 8/39 (21%)
M14_CP_A-B_like 125..423 CDD:199844 108/300 (36%)
LOC100489361XP_017952843.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D208397at33208
OrthoFinder 1 1.000 FOG0000073
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.