DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: und and metap2a

Sequence 1:NP_001260299.1 Gene:und FlyBaseID:FBgn0283478 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_001093524.1 Gene:metap2a ZFINID:ZDB-GENE-061013-5 Length:468 Species:Danio rerio

Alignment Length:433 Identity:290/434 (67%)
Similarity:341/434 (79%) Gaps:17/434 (4%)


  Fly    17 GE-EVKKQKKPKPNNKKLRQEAAAKIASGEGGDEELTTNGDAKPATPAAQPAKKKGNKGKKSGQT 80
            || ||||..:.:...:|.|:|...     |.|:|...|:|..|    ..:|.||||.|    .||
Zfish    52 GELEVKKPLEQQNLEEKEREEDGE-----EDGEEADNTSGKKK----KKKPKKKKGPK----TQT 103

  Fly    81 DPPTIPIAKLYPDGNFPEGEIVEHPTPKDMPDDRTAKDRFTSEEKRALDRINTDIYQELRQAAEA 145
            |||::||..|||.|.||.|:..|:|..:   |.|:|..|.:.||||.||..|.:::.:.||||||
Zfish   104 DPPSVPICDLYPSGVFPVGQECEYPPSQ---DGRSAAWRMSDEEKRVLDEANEEMWSDFRQAAEA 165

  Fly   146 HRQTRQYMQRYIKPGMTMIQICEELENTARRLIGENGLEAGLAFPTGCSLNHCAAHYTPNAGDPT 210
            |||.|:|::.:||||||||.|||.||..:||||.|:||.||||||||||||:|||||||||||||
Zfish   166 HRQVRRYVKSWIKPGMTMIDICERLEACSRRLIKEDGLNAGLAFPTGCSLNNCAAHYTPNAGDPT 230

  Fly   211 VLQYDDVCKIDFGTHIKGRIIDCAFTLTFNNKYDKLLQAVKEATNTGIREAGIDVRLCDIGAAIQ 275
            ||:|||||||||||||.|||||||||:|||.|:|.||:||.:||||||:.|||||||||:|.:||
Zfish   231 VLRYDDVCKIDFGTHINGRIIDCAFTVTFNPKFDHLLEAVADATNTGIKCAGIDVRLCDVGESIQ 295

  Fly   276 EVMESYEIELDGKTYPIKAIRNLNGHSISPYRIHAGKTVPIVKGGESTRMEEDEFYAIETFGSTG 340
            |||||||:|:|||||.:|.|||||||||..||||||||||||||||:|||||.|.||||||||||
Zfish   296 EVMESYEVEIDGKTYQVKPIRNLNGHSIGQYRIHAGKTVPIVKGGEATRMEEGEVYAIETFGSTG 360

  Fly   341 RGLVHDDMDCSHYMKNFDLPFVPLRLQSSKQLLGTINKNFGTLAFCKRWLDRAGATKYQMALKDL 405
            :|:|||||||||||||||:..||:||..:|.||..:|:||||||||:|||||.|.:||.||||:|
Zfish   361 KGVVHDDMDCSHYMKNFDVGHVPIRLPRAKHLLNVVNENFGTLAFCRRWLDRLGESKYLMALKNL 425

  Fly   406 CDKGIVEAYPPLCDIKGCYTAQYEHTIMLRPTCKEVVSRGDDY 448
            ||.||::.||||||.||.||||:||||:|||||||||||||||
Zfish   426 CDLGIIDPYPPLCDTKGSYTAQFEHTILLRPTCKEVVSRGDDY 468

Known Domains:


GeneSequenceDomainRegion External IDIdentity
undNP_001260299.1 PTZ00053 <79..448 CDD:240246 268/369 (73%)
MetAP2 136..444 CDD:238521 237/308 (77%)
metap2aNP_001093524.1 PTZ00053 <101..468 CDD:240246 268/370 (72%)
MetAP2 156..464 CDD:238521 237/308 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C73719704
eggNOG 1 0.900 E1_COG0024
Hieranoid 1 1.000
Homologene 1 1.000 H4981
Inparanoid 1 1.050 603 1.000 Inparanoid score I888
OMA 1 1.010
OrthoDB 1 1.010 D247763at33208
OrthoFinder 1 1.000 FOG0002554
OrthoInspector 1 1.000 T597572
orthoMCL 1 0.900 OOG5_127231
Panther 1 1.100 O PTHR45777
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R57
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.