| Sequence 1: | NP_001260299.1 | Gene: | und / 34294 | FlyBaseID: | FBgn0283478 | Length: | 448 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_609401.2 | Gene: | CG5188 / 34428 | FlyBaseID: | FBgn0032247 | Length: | 317 | Species: | Drosophila melanogaster | 
| Alignment Length: | 431 | Identity: | 77/431 - (17%) | 
|---|---|---|---|
| Similarity: | 130/431 - (30%) | Gaps: | 139/431 - (32%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    30 NKKLRQEAAA-------KIASGEGGDEELTTNGDAKPATPAAQPAKKKGNKGKKSGQTDPPTIPI 87 
  Fly    88 AKLYPDGNFPEGEIVEHPTPKDMPDDRTAKDRFTSEEKRALDRINTDIYQELRQAAEAHRQTRQY 152 
  Fly   153 MQRYIKPGMTMIQICEELENTA-RRLIGENGLEAGL---AFPTG-C-SLNHCAAHYTPNAGDPTV 211 
  Fly   212 LQYDDVCKIDFGTHIKGRIIDCAFTLTFNNKYDK---LLQAVKEATNTGIREAGIDVRLCDIGAA 273 
  Fly   274 IQEVMESYEIELDGKTYPIKAIRNLNGHSISPYRIHAGKTVPIVKGGESTRMEEDEFYAIETFGS 338 
  Fly   339 TGRGLVHDDMDCSHYMKNFDLPFVPLRLQSSKQLLGTINKNFGTLAFCKRWLDRAGATKYQMALK 403 
  Fly   404 DLCDKGIVEAYPPLCDIKGCYTAQYEHTIMLRPTCKEVVSR 444 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| und | NP_001260299.1 | PTZ00053 | <79..448 | CDD:240246 | 66/375 (18%) | 
| CG5188 | NP_609401.2 | MetAP1 | 79..315 | CDD:238519 | 59/330 (18%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45456471 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0024 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.740 | |||||