DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment und and CG5188

DIOPT Version :9

Sequence 1:NP_001260299.1 Gene:und / 34294 FlyBaseID:FBgn0283478 Length:448 Species:Drosophila melanogaster
Sequence 2:NP_609401.2 Gene:CG5188 / 34428 FlyBaseID:FBgn0032247 Length:317 Species:Drosophila melanogaster


Alignment Length:431 Identity:77/431 - (17%)
Similarity:130/431 - (30%) Gaps:139/431 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 NKKLRQEAAA-------KIASGEGGDEELTTNGDAKPATPAAQPAKKKGNKGKKSGQTDPPTIPI 87
            |..:||:..|       |:....|..|::.:.|...|.....:..||..                
  Fly     8 NSLMRQKTTARNLFQFGKVKGDTGKYEQIVSTGQVSPERFVPEEIKKPA---------------- 56

  Fly    88 AKLYPDGNFPEGEIVEHPTPKDMPDDRTAKDRFTSEEKRALDRINTDIYQELRQAAEAHRQTRQY 152
               |...|.|.|..:..|         ..|.:...:..|...|:...|.:|..:.|.....|   
  Fly    57 ---YYFKNMPPGNTLGSP---------EIKSQVQIDAMRLSGRLAARILRECGKLATVGTTT--- 106

  Fly   153 MQRYIKPGMTMIQICEELENTA-RRLIGENGLEAGL---AFPTG-C-SLNHCAAHYTPNAGDPTV 211
                           ::::..| .|::......:.|   .||.. | |:|:.|.|..|   |...
  Fly   107 ---------------DQIDAFAHERILESKAYPSPLRYAGFPKSICTSINNIACHGIP---DDRQ 153

  Fly   212 LQYDDVCKIDFGTHIKGRIIDCAFTLTFNNKYDK---LLQAVKEATNTGIREAGIDVRLCDIGAA 273
            |...|:..||....:.|...||:.|....|..::   |::|.|...:..|...|..|...:||..
  Fly   154 LADGDIINIDVTVFLNGYHGDCSETFRVGNVDERGGFLVEATKSCLDQCISLCGPGVEFNEIGKF 218

  Fly   274 IQEVMESYEIELDGKTYPIKAIRNLNGHSISPYRIHAGKTVPIVKGGESTRMEEDEFYAIETFGS 338
            |....:.::         :.:|....||.|..|                                
  Fly   219 IDRYCDEHD---------LASIAAFIGHGIGSY-------------------------------- 242

  Fly   339 TGRGLVHDDMDCSHYMKNFDLPFVPLRLQSSKQLLGTINKNFGTLAFCKRWLDRAGATKYQMALK 403
                 .|...:..||...     :|.::|.            |.....:..|...||        
  Fly   243 -----FHGPPEILHYYNE-----IPGKMQP------------GMTFTIEPILSLGGA-------- 277

  Fly   404 DLCDKGIVEAYPPLCDIKGCYTAQYEHTIMLRPTCKEVVSR 444
               :..:::.......:.|..:||:||||::..|..|:::|
  Fly   278 ---EIAVLQDGWTAISLDGARSAQFEHTILITETGTEILTR 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
undNP_001260299.1 PTZ00053 <79..448 CDD:240246 66/375 (18%)
CG5188NP_609401.2 MetAP1 79..315 CDD:238519 59/330 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456471
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.