DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf11 and taf11

DIOPT Version :8

Sequence 1:NP_723484.1 Gene:Taf11 / 34293 FlyBaseID:FBgn0011291 Length:196 Species:Drosophila melanogaster
Sequence 2:NP_593491.1 Gene:taf11 / 2543276 PomBaseID:SPAC1002.04c Length:199 Species:Schizosaccharomyces pombe

Alignment Length:197 Identity:65/197 - (32%)
Similarity:100/197 - (50%) Gaps:17/197 - (8%)


  Fly     7 PTQQKSNSLSDGDDVDLKFFQSASGERKDSDTSDPGNDADRDGKDADG-----DNDNKNTDGDGD 66
            |..|:|.|....:       ...:|....::|:.|..:.....|:.:.     :||.:..|.| |
pombe    11 PRFQRSMSYDQSN-------SPTAGAHAKANTASPAAEPAPSSKEKENWNRQEENDLEEDDRD-D 67

  Fly    67 SGEPAHKKLKTKK-ELEEEERERMQV--LVSNFTEEQLDRYEMYRRSAFPKAAVKRLMQTITGCS 128
            .|..|..|:..|. |.::|..|:::.  |:.:|.|||:.|||::||:...|..||:|...|...|
pombe    68 FGTAAISKVAGKPGETDDEANEKLRTKYLLESFDEEQMQRYEVFRRANLNKTNVKKLANQILNQS 132

  Fly   129 VSQNVVIAMSGIAKVFVGEVVEEALDVMEAQGESGALQPKFIREAVRRLRTKDRM-PIGRYQQPY 192
            |:.||.|.:||.:||||||:||.|..:.:..|::|.|.|..:|||.|..|...|: |..|:....
pombe   133 VTPNVAIVISGFSKVFVGEIVELARKIQDQWGDTGPLSPDHLREAYRLSRQNRRLYPQSRHVSHL 197

  Fly   193 FR 194
            ||
pombe   198 FR 199

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Taf11NP_723484.1 TAFII28 91..175 CDD:282562 38/85 (45%)
taf11NP_593491.1 TAF40 1..199 CDD:227576 63/195 (32%)
Ribosomal_P1_P2_L12p <25..69 CDD:304398 9/44 (20%)
TAFII28 96..179 CDD:282562 38/82 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 93 1.000 Inparanoid score I1693
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002835
OrthoInspector 1 1.000 T1124520
orthoMCL 1 0.900 OOG5_129090
Panther 1 1.100 LDO PTHR13218
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1469
TreeFam 1 0.960
87.950

Return to query results.
Submit another query.