DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Taf11 and taf11

DIOPT Version :8

Sequence 1:NP_723484.1 Gene:Taf11 / 34293 FlyBaseID:FBgn0011291 Length:196 Species:Drosophila melanogaster
Sequence 2:XP_012812116.1 Gene:taf11 / 100151705 XenbaseID:XB-GENE-491199 Length:254 Species:Xenopus tropicalis

Alignment Length:194 Identity:94/195 (48%)
Similarity:133/195 (68%) Gaps:24/195 (12%)


  Fly     2 DEILFPTQQKSNSLSDGDDVDLKFFQSA--SGERKDSDTSDPGNDADRDGKDADGDNDNKNTDGD 64
            |.:|  .||..:...||:| ::|..:|.  ||..:..:|||..: |.|..|              
 Frog    83 DRVL--VQQVKSEQEDGED-EVKVAESPEHSGVTEPIETSDLAS-ASRKVK-------------- 129

  Fly    65 GDSGEPAHKKLKTKKELEEEERERMQVLVSNFTEEQLDRYEMYRRSAFPKAAVKRLMQTITGCSV 129
                ..|.::.:.|::::|:|.::||:|||:|:||||:||||||||||||||:|||:|.||||||
 Frog   130 ----LEAKERREKKQKVDEDEIQKMQILVSSFSEEQLNRYEMYRRSAFPKAAIKRLIQNITGCSV 190

  Fly   130 SQNVVIAMSGIAKVFVGEVVEEALDVMEAQGESGALQPKFIREAVRRLRTKDRMPIGRYQQPYF 193
            |||||||||||:||||||||||||||.|..|::..|||:.:|||:|||:::.::|..:|::..|
 Frog   191 SQNVVIAMSGISKVFVGEVVEEALDVCEKWGDNPPLQPRHMREALRRLKSRGQIPNSKYKKIMF 254

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Taf11NP_723484.1 TAFII28 91..175 CDD:282562 65/84 (77%)
taf11XP_012812116.1 TAF40 55..252 CDD:227576 93/191 (49%)
TAFII28 152..236 CDD:282562 65/84 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H55918
Inparanoid 1 1.050 160 1.000 Inparanoid score I4035
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002835
OrthoInspector 1 1.000 T1058807
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1469
TreeFam 00.000 Not matched by this tool.
66.080

Return to query results.
Submit another query.