DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: zf30C and wor

Sequence 1:NP_477301.1 Gene:zf30C FlyBaseID:FBgn0270924 Length:777 Species:Drosophila melanogaster
Sequence 2:NP_476601.1 Gene:wor FlyBaseID:FBgn0001983 Length:548 Species:Drosophila melanogaster

Alignment Length:647 Identity:130/648 (20%)
Similarity:211/648 (33%) Gaps:214/648 (33%)


  Fly   125 PREESRPMECKCCYTRFSSASNLSKHRRSR-------------PDT------------CGQPEYD 164
            |..:..|.|.:   .||.:|.|.:|.:.:|             ||.            .|..|::
  Fly    55 PEPQPVPTELR---RRFDAAMNQTKEQLARRIWEETREIARAFPDVFTREEIAKSLARLGYGEFE 116

  Fly   165 SPGSSDGMKKHKAFRKKDRNRDSDDEDTTSEESEDSDDDIPLASRLKTKLKQESQNSDSGDECPD 229
            .|                      .|:...|...:.:..:||                       
  Fly   117 LP----------------------PEEEVMEPEPEPEQHLPL----------------------- 136

  Fly   230 FEPNNSEDDADASGFQLPPPAMVKVEAFDEEDFEYQDASMYVKTESTDIFSNEKDKLLDVLLNEG 294
                  ....|||      |.::|.|..|||.|.                          |.|..
  Fly   137 ------RYTRDAS------PTIIKAEPSDEEQFP--------------------------LRNYN 163

  Fly   295 DGLKPFESLKVEQGAGILDEIAAVPLVEVAE-EDVLELRGHQMEKPPGPRKRGRPPKEKIPVVKR 358
            :.|                      |..:|| ||.::::..:.|.||.|     .|:...|    
  Fly   164 NNL----------------------LKSIAEYEDCMKMQNIKEEIPPIP-----SPQLFYP---- 197

  Fly   359 KYRKRNAPRSP--SPDDSSGTPKRVAKISKKELKERLKMINKMEKSWKCPHCVKIYHIRKPYEKH 421
                   |.:|  .|:|.|.|.:||       |.|.:.:.|.........|... .|...|.:  
  Fly   198 -------PPTPLAEPEDLSVTQRRV-------LSENMNLQNVARALLSMQHMAP-QHAPPPID-- 245

  Fly   422 LRDDHKLNEAEMKEIFKDVDVHAKLDEEVFKCPICSKIYLVEKRLVTHMKVH------------- 473
            :.:|.:..:....:|....|::       ::|..|:|.|.....||.|.:.|             
  Fly   246 MEEDQENQDINQLKIKSSNDLY-------YQCQQCNKCYATYAGLVKHQQTHAYESTEYKIIRSQ 303

  Fly   474 -GEDGKLTFKCPCYCNLFFATKEQATEHARAQHKE------LLYCEKCDKYMTGHDSLKNHERNF 531
             |..|.:..:.. :|....:...||...|.||..:      ..:|:.|.|..:.:..|..|:: |
  Fly   304 PGGSGAIVDQTE-FCTDQASALIQAANVASAQSMQKPVGVPRYHCQDCGKSYSTYSGLSKHQQ-F 366

  Fly   532 HSKKEPRSQQRNLI-CDKCGKKFTGRTSLSDHVRSDCGRLPLYGCSVCGKHLSTAGILKTHMLLH 595
            |......:|.:.:. |..|.|.:....:|..|:|:.  .||. .|.:|||..|...:|:.|:..|
  Fly   367 HCPSAEGNQVKKVFSCKNCDKTYVSLGALKMHIRTH--TLPC-KCPICGKAFSRPWLLQGHIRTH 428

  Fly   596 KADTPYQCDKCGKTFKVKAQYKSHLKTRHTDYKPYKCHLCPKEYPYRESLLTHM-----TVHTGI 655
            ..:.|:.|..|.:.|..::..::|::| |:|.|.|.|..|.|.:.....|..|:     |..:|.
  Fly   429 TGEKPFSCQHCNRAFADRSNLRAHMQT-HSDVKKYSCPTCTKSFSRMSLLAKHLQSGCQTEQSGG 492

  Fly   656 KRFLCNNCGKRFTCISNLQAHRKVHADTCGQLPLNAKATQYMGVQRGKLLMGAKPEAGMEYE 717
            .    :..|..|. ...||.|.:|:.:  |..|........:|...|      :.|.|.||:
  Fly   493 P----SGSGGGFD-QQQLQQHLQVYEE--GHNPHQLYYAGSVGSSNG------EEEEGGEYQ 541

Known Domains:


GeneSequenceDomainRegion External IDIdentity
zf30CNP_477301.1 C2H2 Zn finger 33..53 CDD:275368
C2H2 Zn finger 61..82 CDD:275368
C2H2 Zn finger 98..117 CDD:275368
C2H2 Zn finger 134..152 CDD:275368 5/18 (28%)
C2H2 Zn finger 511..532 CDD:275370 6/21 (29%)
COG5048 <523..>672 CDD:227381 40/155 (26%)
C2H2 Zn finger 546..566 CDD:275368 6/20 (30%)
C2H2 Zn finger 575..595 CDD:275368 7/20 (35%)
C2H2 Zn finger 603..624 CDD:275368 5/21 (24%)
C2H2 Zn finger 632..652 CDD:275368 6/25 (24%)
C2H2 Zn finger 660..680 CDD:275368 6/20 (30%)
worNP_476601.1 C2H2 Zn finger 270..290 CDD:275368 7/20 (35%)
C2H2 Zn finger 317..334 CDD:275368 5/17 (29%)
zf-C2H2 345..367 CDD:278523 6/23 (26%)
C2H2 Zn finger 347..367 CDD:275368 6/21 (29%)
PHA00732 379..>417 CDD:177300 13/41 (32%)
C2H2 Zn finger 382..402 CDD:275368 6/20 (30%)
zf-C2H2_8 405..482 CDD:292531 24/79 (30%)
zf-C2H2 406..428 CDD:278523 7/23 (30%)
C2H2 Zn finger 408..428 CDD:275368 7/20 (35%)
zf-H2C2_2 421..444 CDD:290200 7/23 (30%)
zf-C2H2 434..456 CDD:278523 5/23 (22%)
C2H2 Zn finger 436..456 CDD:275368 5/21 (24%)
zf-H2C2_2 448..473 CDD:290200 9/26 (35%)
C2H2 Zn finger 464..481 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24409
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.