DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pka-C1 and Akt2

DIOPT Version :10

Sequence 1:NP_476977.1 Gene:Pka-C1 / 34284 FlyBaseID:FBgn0000273 Length:353 Species:Drosophila melanogaster
Sequence 2:XP_008757330.1 Gene:Akt2 / 25233 RGDID:2082 Length:496 Species:Rattus norvegicus


Alignment Length:119 Identity:27/119 - (22%)
Similarity:37/119 - (31%) Gaps:17/119 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FEQGYLSRYGNIELNPAAGILNYGQGLIEGMKAYR-------GEDGRVLLFRPELNAMRMKIGAE 69
            |...:..||.|   .|...:||||........:||       |..|.      ..|.|.:.:...
  Rat     5 FVNSFSGRYPN---GPDYQLLNYGTSSSAMNASYRDSGTMHSGSYGY------NYNGMDLSVNRS 60

  Fly    70 RMCMHSPSVHQFIEGVKQTVLANRRWVPPPGKGSLYLRPLLFGSGASLGVAAAS 123
            ....|..:|.. ...|.|:.....|:..|.........||...:..|||...:|
  Rat    61 TSTGHFGAVGD-NSRVFQSPAPETRFRQPSSCSLASPEPLPCSNSESLGPKGSS 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pka-C1NP_476977.1 STKc_PKA 44..333 CDD:271111 18/87 (21%)
Akt2XP_008757330.1 PH_PKB 32..126 CDD:269947 18/89 (20%)
STKc_PKB_beta 171..493 CDD:173686
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.