DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Apoltp and vtg4

Sequence 1:NP_995670.2 Gene:Apoltp FlyBaseID:FBgn0032136 Length:4333 Species:Drosophila melanogaster
Sequence 2:NP_001038759.2 Gene:vtg4 ZFINID:ZDB-GENE-001201-3 Length:1358 Species:Danio rerio

Alignment Length:1652 Identity:303/1653 (18%)
Similarity:575/1653 (35%) Gaps:462/1653 (28%)


  Fly    49 EQLYKYQYTVAVRTEFAGSGDNSSDLLLKSDLEIFFPKPCEGY----LRINDAKLYDTLDELNDN 109
            ::.|||:|                :.||...|      |.||.    ::::...|...:      
Zfish    27 DKTYKYKY----------------EALLLGGL------PQEGLARAGIKVSSKVLLSAV------ 63

  Fly   110 ESDSSEKTKEYDYYDNLANEESESQNYDNMHPKSSDFNVDLTKNL-------LRFAFHDGLISEV 167
                :|.|......|.|..|.:.:...|:..|.:.     ||..|       ::|.:.:|::.:|
Zfish    64 ----TENTYLMKLMDPLLYEYAGTWPKDSFVPATK-----LTSALAAQLQIPIKFEYANGVVGKV 119

  Fly   168 CPQEQETPWVLNIKKGILSAFQNTMMRFDVDANTTETDVSGQCQVQYAL-EDTDSSYVTIRKTKD 231
            ......:|.|:|:.:|||:..|..:.:........|....|.|:..|.: ||..::::.:.|:||
Zfish   120 FAPAGVSPTVMNLHRGILNILQLNLKKTQNIYELQEAGAQGVCRTHYVINEDPKTNHIIVTKSKD 184

  Fly   232 INSCRQRYATHSVLQTTPYTFRDDKTIWPILKSQSHCNLTIDNNVYKEIKCLETHLLVPFSNASS 296
            ::.|::|......|..|.......|.:..::::.::                 .:::.|   |.:
Zfish   185 LSHCQERIMKDVGLAYTERCAECTKRVKSLIETATY-----------------NYIMKP---ADN 229

  Fly   297 GALTTSTSRLKLDGVES-YSAGEFLE-QNPELVERRATLVF---DHTPAVKPSHD-------EIK 349
            |||....:      ||. |....|.| ....::|.:.||.|   :.||.|....|       :.:
Zfish   230 GALIAEAT------VEEVYQFSPFNEIHGAAMMEAKQTLAFVEIEKTPVVPFKADYMHRGSLQYE 288

  Fly   350 AARELL---VEMCRVGFPNIQREFIDVFTNFLQTSKS-------LDYKTLSVLLQRSASTCEQ-- 402
            .|.|:|   :::.::.  :...:.::|..:.:..:|.       |.:..|..||:  .:|.|:  
Zfish   289 FATEILQTPIQLMKIS--DAPAQIVEVLKHLVANNKDMVHDDAPLKFVQLVQLLR--VATLEKIE 349

  Fly   403 -----------GRNHLLESLPFIGSTASYKVMRDQII-NEKLTKQMAHDWMTALSFITRPDEETL 455
                       .|..||::||.:|:....|.::::.: .|..|.:.....:.||..:: .|.||:
Zfish   350 AIWSQFKDKPVYRRWLLDALPAVGTPVIIKFIKEKFLAGEFTTPEFIQTLVIALQRVS-ADLETI 413

  Fly   456 ETFHSILEYAK----NRLDAEYTLGATAVVHSFCKHHEACEENLRVQQIINLLETEFLNLYNLFK 516
            :...|:..:.|    ..|.....||..:::...|.....|...|  .:.|:.:.||.::..::  
Zfish   414 QMTASLAMHEKFSTVPALREVAMLGYGSLIARHCIAVPTCPAEL--LRPIHEIATEAVSKNDI-- 474

  Fly   517 GERRTRERMVILLKGLGNIGVVSSAFAEQLQWIIR--------EDEAPVDIRLHGILAFRRVDCA 573
                  ..:.:.||.:||.|..||     |:.|::        .:..||.:::..|||.|.:...
Zfish   475 ------PEITLALKVMGNAGHPSS-----LKPIMKLLPGLRTAANALPVRVQVDAILALRNIAKK 528

  Fly   574 RHR-------SYFLDNYGNYTLNSELRIYSYLQAMRCPDYISVGVIKSI---LEHEEINQVGSFV 628
            ..:       ...||.    .|:.|:|:.:.:.......  ||.:|.|:   |..|....|.||.
Zfish   529 EPKLVQPIALQLVLDR----ALHPEVRMVACIVLFEAEP--SVALISSLAGALRTEPNMHVASFA 587

  Fly   629 WSHLTNLAKSNSPVRIEAQGL------LLNDELSERFKMDIRKFSRNYEHSLFFDEYNFGTTTDA 687
            :||:.:|.:..:|......|.      |:|.:|.   :::.| :||.::...::.....|....|
Zfish   588 YSHIKSLTRITAPDMAYVAGAANVAIKLMNCKLD---RLNYR-YSRAFKMDYYYTPLMIGAAGSA 648

  Fly   688 NVIFGTDSYLPRIASVNFTADLFGQSVNFFEFTARAEGLEELAANAFGPKGPLSGQLLRKKLSFL 752
            .:|....:.|||.......|.|.|.:.:..||..|..|:.|...     |.|             
Zfish   649 YMINDAATILPRAVVAKARAYLAGAAADVVEFGVRTGGIHEALL-----KSP------------- 695

  Fly   753 NRWLGNESAEEDDTLENLLSLDNLRLKRKAQEQARASEEEVDEDYDFEESLEGNKRQKRDVSTTR 817
                                               |::|.||.       :...||..|.::..:
Zfish   696 -----------------------------------AADESVDR-------ITKIKRTLRALTNWK 718

  Fly   818 KQEIDRNVDSLGYKLKYDYNNPRAQFGLRVFGNDLRYFNVESLVEVMALAAKFNPFQQA------ 876
            ....|:               |.|...::|||.::.|.|.:..:...|:.....|..:|      
Zfish   719 ALPTDK---------------PLASAYVKVFGQEVAYVNFDKTIIEEAIPMVTGPKPRALLKEAL 768

  Fly   877 KNVLSGKEFTYTKSRVFLDASYTVPLAVGLPLAIH----AFGASSIDLRVS------GNLDEMD- 930
            |.:..|..|.|.|..:..:....:|.|||:|:...    |..|:|::::.:      ..|:.|. 
Zfish   769 KALQEGIAFQYAKPLLAAEVRRILPTAVGVPMEFSWYTAAVAAASVNVQATVTPALPEKLESMTY 833

  Fly   931 ---PPTDWHFDVEGQFKPSVSVDVITTMQTDMFWEQSGIKVKSNLYSNSELVAKLKVRGR----- 987
               ..||..|..|.  :|||::.....|..:..:.|:.:..:..:    ..:|..||..|     
Zfish   834 EQLKKTDVQFQAEA--RPSVALQTFAVMGVNTAFIQAAVMARGKI----RTIAPGKVAARADILK 892

  Fly   988 ---NLVSFSFDLPRDKNEIFSVRSELLVQKREEQLPQAGIANRSANSTCTWPVLDQAIGLQMCSH 1049
               .:.:...|||   ..|.|...|.|...|       .|.:.||..:.  |.:.: :.||....
Zfish   893 GNYKVEALPVDLP---EHIASASFETLAVVR-------NIEDHSAERSV--PFVPE-LSLQNSQA 944

  Fly  1050 YSVPDLSNATEIYPSLLLAGPLNFSLILKKSDLSAKKYVFEYKWDQQEEDNNFSLVFTTPGSKVP 1114
            ....|||  :|:.|...:..|..|...|    ..|..|: |.|...:...:|.:.:         
Zfish   945 SYAGDLS--SEVSPDASVRAPAPFDRTL----CYAVPYI-EIKGCVEVHSHNAAFI--------- 993

  Fly  1115 RVLVANVTKVPDAFNASVAFVNGPNRVSAGCSYDGNPDFRRLDIYLDTNGNRSLDLGMELRRHQD 1179
                         .|:::.::.|.:...|..|....|...||:..:.. |.|:.:          
Zfish   994 -------------RNSTLFYIIGHHTARAAVSRAEGPAVERLEFEVQV-GPRAAE---------- 1034

  Fly  1180 FTAWIYNPRMLLAINGVN---ITGLAGTVKVNEKNGIKQHDVDLSFETKKLQAVIKGNVVQSEIT 1241
                    |:|..||.::   ..|.|..:|:.|                .|....|...|.||.:
Zfish  1035 --------RLLKQINIIDDDTPEGQAFLLKLRE----------------ILDTEAKNAPVSSESS 1075

  Fly  1242 TSTNMTIKYRFQANKIEEINFAGKLVNNGDKSKTEYRGNMKLQTSAYPKLNFASESTWLSLQGHT 1306
            :|::...:                                          :.:|.||..|..|.:
Zfish  1076 SSSSRNSR------------------------------------------STSSSSTSTSSSGSS 1098

  Fly  1307 EGMITYNNAPDYVNPNYTSLVRLIFARSHSEDSFLDGTQTRASLELKLPRSKIDYRILVKHKEHI 1371
            ....:.:::......:.|:.:...|.:.| :|.:|  ....|:.:.....:...:..:.|....:
Zfish  1099 SSSSSSSSSMSSSRMSKTATIMEPFRKFH-KDRYL--APHSATKDTSSGSAAASFEQMQKKNRFL 1160

  Fly  1372 KNGTEH-NVIVGLKYTPEKEITGLFSVHLPRRNLFAIDAYMNVTVPEFNSCTASLKVNEKATKDY 1435
            .|.... ..|:......::::.|           :.:.||.:..........:|:..|:...   
Zfish  1161 GNDIPPVFAIIARAVRADQKLLG-----------YQLAAYFDKPTARVQLIASSIAENDNMK--- 1211

  Fly  1436 IIFINGSWFTGHSVAVKANY--KDRSSRVQALHHLKMIVESPSF-------NITSLNIIYRRKQL 1491
             |..:|:..:.|.|..|.::  :.:...|.|.....::.|.|:.       .:..:...|.:|  
Zfish  1212 -ICADGALLSKHKVTAKFSWGAECKQYAVFAKAEAGVLGEYPAARLEVEWERLPKIASTYAKK-- 1273

  Fly  1492 LIFYDIQAKYDQDPYGLTIQYASNAHNRNTNAEVRLKVKERDYWINAKLLSEQPKLLQL-----E 1551
            :..|.:.|.||.   |...:.|:|:              |::..:.|.|.|:  |.|.:     |
Zfish  1274 VSKYILNAAYDT---GFRFERATNS--------------EKEIELTAALPSQ--KSLNVIARIPE 1319

  Fly  1552 IHMDKIRDVHIQV-------GLLNVDK 1571
            |.|.: ||:::.|       |...:||
Zfish  1320 ITMSR-RDIYLPVTVPINPDGTFTIDK 1345

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ApoltpNP_995670.2 LPD_N 49..633 CDD:214755 130/654 (20%)
DUF1943 665..1012 CDD:286281 71/375 (19%)
DUF1081 1029..1122 CDD:283982 17/93 (18%)
VWD 3741..3908 CDD:295339
C8 3951..4014 CDD:285899
vtg4NP_001038759.2 Vitellogenin_N 24..592 CDD:279663 130/654 (20%)
DUF1943 626..917 CDD:286281 72/376 (19%)
DUF1944 1166..1330 CDD:286284 35/201 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23345
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.