DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Apoltp and apoba

Sequence 1:NP_995670.2 Gene:Apoltp FlyBaseID:FBgn0032136 Length:4333 Species:Drosophila melanogaster
Sequence 2:XP_694827.7 Gene:apoba ZFINID:ZDB-GENE-070702-4 Length:4418 Species:Danio rerio

Alignment Length:5077 Identity:978/5078 (19%)
Similarity:1676/5078 (33%) Gaps:1616/5078 (32%)


  Fly    12 LLLLIAHTQA----VRENPLKDPRICGRPQCDSKSAKFNYGEQLYKYQYTVAVRTEFAGSGDNSS 72
            ||.|.||..|    |.|...:     |..:| ..||:|. ..:.|.||||...:....|:.:..:
Zfish     8 LLFLSAHLLAGSTEVAEEDTE-----GLSKC-PLSARFK-NLRKYVYQYTAESKNGVTGTANLKN 65

  Fly    73 DLLLKSDLEIFFPKPCEGYLRINDAKLYDTLDELNDNESDSSEKTKEYDYYDNLANEESESQNYD 137
            ...:...:||..|:.|...||..:.    .|.|::..::...      ..|...|..|:      
Zfish    66 GPKISCQVEIEVPQTCSFVLRTTEC----VLSEVSVIDAQGQ------PVYRQAAGAEA------ 114

  Fly   138 NMHPKSSDFNVDLTKNLLRFAFHDGLISEVCPQEQETPWVLNIKKGILSAFQNTMMRFDVDANTT 202
                    |...:.||.|.|.........:.|:|.|...:||||:||:||....::  :.:.|..
Zfish   115 --------FQAAMEKNTLNFVVDQVTSVSIYPEEDEPENILNIKRGIISALLVPVL--EEEHNER 169

  Fly   203 ETDVSGQCQVQYALEDTDSSYVTIRKTKDINSCRQRYATHSVLQTTPYTFRDDKTIWP------- 260
            .:.:.|.|:.:..:.......:.:...:|::.| ..::.|| |.|:|.      ::.|       
Zfish   170 MSTIHGICKTEVTVNSRKDIDIDVSVVRDLSDC-SHFSPHS-LSTSPL------SLMPGLNGLFS 226

  Fly   261 -ILKSQSHCNLTIDN--NVYKEIKCLETHLLVPFSNASSGALTTSTSR-LKL-DGVE----SYSA 316
             :::|...||...||  ....|.:|.|.||.:|||:.....:::...: |.| |.|:    .::.
Zfish   227 KLIRSTQTCNYQFDNRRKHMTEAQCTEKHLFIPFSHEGQYGISSEVKQSLTLQDSVKINNRYFNK 291

  Fly   317 GEFLEQNPELVERRATLVFDHTPAVKPSHDEIKAARELLVEMCRVGFPNIQREFIDVFTNFLQTS 381
            .:.||:...:.|     |.|..|.  .|.|::.|..:.|:.:...| .:.||  ..:|...:...
Zfish   292 DDTLEKKLFIEE-----VEDKHPV--QSKDDVLATMKELITLSSSG-KSQQR--ASLFHKLVSEV 346

  Fly   382 KSLDYKTLS----------------VLLQRSASTCEQGRNHLLESLPFIGSTASYKVMRDQIINE 430
            :.|..:|||                .|.|.....|......:|.:.    ..|..:|  |.|:  
Zfish   347 RGLKNETLSGAADEMMKFSEWLTWQTLFQCGTDECTSAIMQILRTF----DEADREV--DAIV-- 403

  Fly   431 KLTKQMAHDWMTALSFITRPDEETLETFHSILEYAKNRLDAEYTLGATAVVHSFCKHHEACEENL 495
                       .|||.:.:...:.|....|:.: :|......|.|..|.             :.|
Zfish   404 -----------YALSLLPQSSPQRLRDMLSMAQ-SKPSKPIMYALANTV-------------KQL 443

  Fly   496 RVQQIINLLET-EFLNLYNLFKGERRTRERMVIL-LKGLGNIGVVSSAFAEQLQWII---REDEA 555
            ...|..:..|. |.........|:....|....| |:.:|.:|.....|......::   ::..|
Zfish   444 PQDQATSTPEVKEVAKFMEFMLGDCSGDEDSTFLTLRVIGVMGKYMEGFPSLKSSVLNCMKQAYA 508

  Fly   556 PVDIRLHGILAFRRVDC-ARHRSYFLDNYGNYTLNSELRIYSYLQAMRCPDYISVGVIKSILEHE 619
            |:.::...|.|||.::. :..||..:..|.|....::.||.:||..||.|: ::..|::: |:.|
Zfish   509 PLPVQKAAIQAFRLMEMDSDVRSALIQQYQNVEAPAQKRIAAYLMLMRNPE-VAENVLRT-LKSE 571

  Fly   620 EINQVGSFVWSHLTNLAKSNSPVRIEAQGLLLNDELSE-RF-KMDIRKFSRNYEHSLFFDEYNFG 682
            :..||.|||.||:.|:.:|.:|....|:..:|.....: .| .||..|.||||:     .|....
Zfish   572 QNEQVKSFVSSHIANILESENPNLSIAKDYILKAVQGDVSFPPMDFTKLSRNYK-----TEVPLV 631

  Fly   683 TTTDANVIFGTDSYLPRIASVNFTADLFGQSVNFFEFTARAEGLEELAANAFGPKGPLSGQLLRK 747
            .:.::||||.:.:|:||...:..|.|.|...:  .|.....||||.:....||..|     ....
Zfish   632 GSVESNVIFDSANYMPREVMLATTLDNFNPEI--LEIGLEGEGLEPVIEVLFGENG-----FFPD 689

  Fly   748 KLSFLNRWLGNESAEE-DDTLENLLS-LDNLRLKRKA-QEQARASEEEVDEDYDFEESLEGNKRQ 809
            .:|....|:.::.... ...||..:| |:..|:||:. |:..::.||.:.|   |:..||    |
Zfish   690 TISKAMYWVNDKIPHPVKRVLEKWISPLNGERMKRQVPQDIMKSMEEYISE---FKNRLE----Q 747

  Fly   810 KRDVSTTRKQEIDRNVDSLGYKLKYDYNNPRAQFGLRVFGNDLRYFNVESL------VEVMALAA 868
            ..|.                         |:....||:||.:|.|.....|      :.:.|...
Zfish   748 VEDA-------------------------PKGLAYLRLFGTELGYLKTSDLKHVTQYINLCAETF 787

  Fly   869 KFNPFQQAKNVLSGKEFTYTKSRVFLDASYTVPLAVGLPLAIHAFGASSIDLRVSGNLDEMDPPT 933
            |.........::|..|..:....:|||.::|:|.:.|.||.:...|..:...:....:|.|..  
Zfish   788 KSTSLNFMGKLISSLENEFFVHYMFLDKAFTLPTSAGFPLKLTLSGVLAPGAKGGLTIDRMMQ-- 850

  Fly   934 DWHFDVEGQFKPSVSVDVITTMQTDM-FWEQSGIKVKSNLYSNSELVAKLKVRGRNLVSFSFDLP 997
                  :..|.|||.|:.||.|...: .:..:||:..:|||..|.:.|::.: ..:.:..|...|
Zfish   851 ------QLSFMPSVGVEFITQMGVYIPEFVVAGIETHTNLYHESAVNARVTL-SDSQIKLSIPAP 908

  Fly   998 RDKNEIFSVRSELL-VQKREEQLPQAGIANRSANSTCT--WPVLDQAIGLQMCS--HYSVPDLSN 1057
            ....::|||.:::| |...:.::..:.:.:|..::.|.  :|      |:..|:  .||....:|
Zfish   909 SGNIQLFSVSNKILSVTSTQTKIVPSMVEDRIDSTECNRIFP------GMNYCTILRYSNASSTN 967

  Fly  1058 ATEIYPSLLLAGPLNFSLILKKSDLSAKKY--------VFEYKWDQQEEDNNFSLVFTTPGSKVP 1114
            ....||   |.|....:|.|:.:. ..::|        :.|.|..:|:.| :..:|....|::..
Zfish   968 NAPYYP---LTGETRLALELQPTG-EVREYTATISYALLREGKEGRQKVD-SVKIVLKAEGAEPT 1027

  Fly  1115 -----------RVLVANVTKVPD-----AFNASVAFVNGPNRVSAGCSYD-GNPDFRRLDIY--- 1159
                       |.::....::||     ....:|...|...:...|.:.| .|.|..:|.|.   
Zfish  1028 EATAVVKYNRNRSILTTDLQIPDYDLEAGIKLAVTDTNAKGKKMRGITIDVTNRDIPQLSIVGHA 1092

  Fly  1160 -LDTNGNRSLDLGMELRRHQDFTAWIYNPRMLLAINGVNITGLAGTVKVNEKNGIKQHDVDLSF- 1222
             |::..:..::|.|.:            |.:.:.      |....|:|.|  ||:.. .::.:| 
Zfish  1093 RLESMRDGLIELQMSV------------PALQMD------TSATATLKKN--NGLVL-QLETAFN 1136

  Fly  1223 --ETKKLQAVI---KGNVVQSEITTSTNMTI--------KYRFQAN-KIEEINFAGKLVNNGDKS 1273
              ||..:|..|   ..|.|:.|:.:..|..:        :||.|.. .|:||.         ||.
Zfish  1137 MPETTSVQKAILRYDNNKVEIEMKSDINSEVEKLFPNMEEYRSQLQASIDEIL---------DKK 1192

  Fly  1274 KTEYRGNMKLQ---TSAYPKLN-----FASESTWLSLQGHTEGMITYNNAPDYVNPNY------- 1323
            .|  :.:|||:   :.....:|     .|:.|:::.:|.:.      .:.|:.:.|:.       
Zfish  1193 VT--KTDMKLRHIVSKGLEAVNIWLDKIAAGSSFVDVQRNK------RSTPELILPSLPEKLYLK 1249

  Fly  1324 -TSLVRLIFARSHSEDS--FLDGTQTRASLE----LKLPRSKIDYRILVKHKEHIKNGTEHNVIV 1381
             .:|:|..|.:.....|  .|.|.::.|.|:    |.||:.:|.                   ::
Zfish  1250 SDALLRYQFNKGRISISLPLLLGGKSSAELDIPPTLTLPQIQIP-------------------LL 1295

  Fly  1382 GLKYTPEKE-------ITGLFSVHLPRRNLFAIDAYMN----------------VTVPEF----- 1418
            ||: .||..       |.......||...:..:.|.||                |.||.:     
Zfish  1296 GLE-VPENSYKIPTFTIPRTLEFSLPMLGVAELSAKMNSNFYEWEGSILGGNNTVDVPNYIAKYK 1359

  Fly  1419 --NSC---TASLKVNEKA--------TKDYIIFING-----------SWFTGHSVAVKANYKDRS 1459
              .||   ..|.|:....        |..|:  :||           |:|...|:|.|.|.: .:
Zfish  1360 IMASCPLTPLSYKIEGMGMISGTVDDTLKYL--VNGSINHCLLDASISFFETMSLADKINGR-TN 1421

  Fly  1460 SRVQALHHLKMIVESPSFNITSLNIIYRRKQLLIFYDIQAKYDQDP----------------YG- 1507
            .|::|        .||....|||           ||..|:....|.                |. 
Zfish  1422 YRLEA--------SSPLGLDTSL-----------FYSAQSASTSDEVIGDGNLDGFIKIGSLYAN 1467

  Fly  1508 --LTIQYASNAHNRNTNAEVRLKVKE---------RDYWINAK--LLSEQPKLLQLEIHMDKIRD 1559
              |:..|..|...:....|..||...         :..::|.:  |||:......:..|:.:::.
Zfish  1468 STLSQSYIYNMPKQEGKGESTLKFDSSLIQGQNVIKGSYVNGELSLLSKTNAQNDVLKHVVELKH 1532

  Fly  1560 VHIQVGLLNVD--------------------KRKELSLELKWDANRDPSQRLGLLA--------E 1596
               :.|.|:|.                    |..|.:|:::..||........||.        |
Zfish  1533 ---KKGELSVKSDGSATALGKALRCKAELDVKNGEATLKVESQANDATHDAFSLLTGSLNSNGLE 1594

  Fly  1597 YN-------------SPGTKHYDGN-----LMITYPERTIHFGFNSFTGGPKYFGKVHASWSI-- 1641
            .|             ..||..:.||     .|.|....::.|. |:|.||....|   ||.|:  
Zfish  1595 INMEGLLNLESGRGTHKGTLSFGGNGLSTSCMTTIEGNSLTFE-NAFNGGINGEG---ASVSVVS 1655

  Fly  1642 -----NEVIEFEYEAGILPGHTLHNWVKAELRT-----PFDGWRVNSLDAGI----YSLKNLI-- 1690
                 :..||...:..|.|       .:|.|.:     .|||...|:::.||    .|:.|.:  
Zfish  1656 KGSSQDNTIELSAKGKISP-------KEASLTSVFQGNAFDGTARNTMNIGINKQGLSMSNTMRG 1713

  Fly  1691 -----------LVNSTLFW--ADDQKLQ------VGYKSDYDV-----------NDQLMSFDVRF 1725
                       .:|.|| |  |...|:.      ..|..|..|           |::|..||  |
Zfish  1714 TLQKMRSECMQTLNITL-WTLAFRSKMDNFICDGASYNHDIKVNMRPFITSISANNELELFD--F 1775

  Fly  1726 GINSTIRDIPTINVKVKHWMDVKKVDTELYL-GYSGQNDTFN-----TYS--------------M 1770
            |::|        :.::|  |:..|:|....| |..|::|:||     ||:              .
Zfish  1776 GLSS--------DGRLK--MEPFKMDVAGSLSGKYGEDDSFNHGCEFTYADLAGTIKCDTAVKVF 1830

  Fly  1771 DS--------------------------SWEIEKNQR------------YNNYSGLVHLVSPFKG 1797
            ||                          |..:|.|.|            ..|..|.|:    |.|
Zfish  1831 DSHISNRFDLDFAGLSSVMNTKTQVNCESLRLENNIRTMAMPFSLTVDAILNSDGTVN----FYG 1891

  Fly  1798 YEKGGLVAHFSLSDQRVVSGAASLNFDLREFTLTM--NG-----YVKKFTDNMLTVNITTPLEKF 1855
            ...|.:.:.|.|..:.:   |.:.:.:.|...:.|  ||     :::...|::|..|..:.|.||
Zfish  1892 KHSGQVSSKFLLKAEPL---AIAKSHECRASAVHMLPNGESAETHIENKFDSLLIPNEQSVLWKF 1953

  Fly  1856 GTINARFGLNEKKRHAVAEVRAPTAALGVEVLADIK-NLLN-----FDVKLS------------- 1901
                 :..||....:....:......:||:....:: ||.|     .|:.|.             
Zfish  1954 -----KSKLNNHAYNQDVNIYNKENDMGVQFSGVLQTNLFNTERESSDIPLDNQKFSTSGFVKYD 2013

  Fly  1902 -------VATP-IESFQQA-------------------------AIFALFN------PERV---- 1923
                   :..| ||||..|                         |:...|.      |::|    
Zfish  2014 KNSDCHIIYFPFIESFPAAFESIKNAILHKFESLQNYLNSLDLNALIGQFRNKLDEFPQKVNDII 2078

  Fly  1924 ---DMRGLWNNVTLGFTGVWHMQNIT--DFEYSYHVFTPLAGFEENGFIVQLLKRKEFVFQLHGK 1983
               |:....|||......:.|...|:  |.:.....|....|          .|..:|..::...
Zfish  2079 VDLDLENKINNVKNQLISLIHDYTISIDDLDAYAERFKEATG----------KKIIDFATKIRDL 2133

  Fly  1984 MSNYKLGVKIN--GEPKSDLVNQLGS--------------------------NKMELEMLYDAD- 2019
            ....|.|::..  ....||::.|:|.                          .:::||.|.|:. 
Zfish  2134 SIQIKDGIESGAWANSVSDILAQIGRELKAFDEQYKITKTIIRGIDGIEDVIRQIDLEKLKDSSA 2198

  Fly  2020 --FKPLNAETDYKPDADE---EYFSYFTNFQVDTLVWPTIVGNVDIQEIIDFYLVVGHVELPQGK 2079
              .|.|:|:.:.|....|   |.......|:::.|:       .|:::.|....:..:|:...|:
Zfish  2199 TWLKQLDAKYEIKTKLLEKLSELRKVVETFEINMLL-------EDLRQYITSIDLTEYVDQLSGQ 2256

  Fly  2080 VEFKD-----------------RLHYPD-----YINVHNLLTVTTPFAVAKNIKSIVEYHVDL-- 2120
            :.::|                 ....|:     |:|...|:   ..:.:.|.|:.|||..:.|  
Zfish  2257 IPYEDIERVLDSAKDVILNWIEEYEVPEKINRVYLNAQELI---LRYEIDKKIEVIVEQAIILVK 2318

  Fly  2121 --------------------------------NFNAFYERVKF--IVNDDKDNTQ---ELGFVFN 2148
                                            :..:..:|:.|  ||||..|..|   :....|:
Zfish  2319 QYRIQELVQAVVDTLKSIQFEYISDKMMEIMDSIVSLLKRMDFQKIVNDLNDYIQLIIKTFRTFD 2383

  Fly  2149 YTALQDNVKPKAHDVQVTLLTPYEMLHEIY-VHGHIELDDNAYKGNISAVTAH----THLSMAAS 2208
            |....|.|..|..|| |..:.  :.::|:| :...||......|...:.|..:    .:..:|..
Zfish  2384 YNTYIDEVNRKVRDV-VDYIN--KQINEVYEIPRKIEASREFIKEMQATVFDYLEKLKNTRIAEV 2445

  Fly  2209 IENEDNFLETSV--GIQLETDAIPHYGCQVYFKKDFSAVDKAIDIRFEVTDNGTLNQLHISTDWH 2271
            ..|..:.::|:.  .|:|:..                  |...|:|..::|....|::.:     
Zfish  2446 CRNIKDVIDTTAYKDIKLKIQ------------------DIIEDVRQRISDMDIRNEISV----- 2487

  Fly  2272 TDPSYIVNANGRIKTTMLPLQMASTSVLVIQGQNPHLNFDLNLLSQNGQSIAYGARANKKKDVFN 2336
                |:..|:|.. ..|:...:...:.|:  .:...:..|..:|.|..|::         :.|||
Zfish  2488 ----YLERASGAY-VNMIEYILTQFTQLI--DEMKKMAEDKEILDQISQAV---------EGVFN 2536

  Fly  2337 ------IEVWTPMKNFRNISMHGTAIRSPRDPGRYDVSGFLYRNMATYEVTGAVRMTNSLPIDVV 2395
                  .:|...|..|..:.:....|:..|   .:|::......:..:.|...:.:. |:.:|..
Zfish  2537 ALKTAEFDVPAFMLPFTTLEIPAFKIKMAR---IHDITIPAMITIPEFTVLDLISLP-SITVDFE 2597

  Fly  2396 LRVQPKAGGRDGVIELNIHEAGPKKI-------------RFSFSAIEDGKM-------------- 2433
            ...|......|.|.::.:.|..|:.|             .|:||.|...::              
Zfish  2598 KIKQSIIDFIDKVRQIEMPEVDPEAIFGDLRALYLSDLPDFTFSEITLSEIKFPEINVPKLKLDS 2662

  Fly  2434 --------------------C-----QMSGGYSVSKTNGAMDFSVLVESTEPEIARINFYGNLSP 2473
                                |     ::.|.:.|......:..|...|:|...:....|...|..
Zfish  2663 FEITMLPIPEVKFPEIPFEPCLPAFGKLYGEFKVDSPYYTLMTSAAFENTTTALKFPQFKATLKS 2727

  Fly  2474 NSEGSLV-------GDLSLETP--WKALGIDTVHL-HSDVGFLNKGGHIV----GEYKIGQYIGR 2524
            |::.||.       ..|.:|.|  .|.:..:||.| |...|..::|..::    .|......:..
Zfish  2728 NAKSSLEFLDYTLDAMLQIEAPKMRKMIISETVSLSHMAFGTEHEGSVVLSGPSAEATAKTAVKV 2792

  Fly  2525 GSCLWSWILAEDMQLVLEN---------YLERPNAKPR-------IVHASAKYQNPGQTFTQLQA 2573
            .:.:::..|..::.:.|:|         |....|. ||       |:..:||.:....|.: |..
Zfish  2793 TTHMYTADLINNIGITLKNGISAYMDTSYNHNLNI-PRLDISSQAIITRTAKARFESGTIS-LTV 2855

  Fly  2574 GGRLSVDS-KWNLDVNGSAEYKSVDDFKFRV-------ITALPLPVGDRHQLSASYQGNVISQQF 2630
            |   :|.| ||: ..|.|...||:||:...:       ||.      :......::.|...|:..
Zfish  2856 G---TVGSGKWS-PSNPSRTVKSIDDYSDEITHKSDFEITV------NAGTAKLNFDGETNSRNL 2910

  Fly  2631 NNPDFVLEASYESFEAQNKLLSRISYKNATNN----LKGLGHVEWGKIQNLSV------VEGDFE 2685
            .        ..:|..|::.:||.|:.......    ||       |.:..|.|      |..:.|
Zfish  2911 K--------MKQSVSAESVILSHITIDARAETEAPFLK-------GSVLTLKVKAQMEDVRMEIE 2960

  Fly  2686 LLHKQGAQREFSAKIITPKFKNEHTFALTGSYDLEKSGHHNVV------GSLDYPASRRITDLDV 2744
            :.|......:.|..|..........|.:|  .|....|:..::      |.:|            
Zfish  2961 ISHSADLIGKVSGSISNTCDFLAQPFEVT--LDCRNKGNSKIILPLKLTGKID------------ 3011

  Fly  2745 SVSSLSNMHGIFNSTLPTFLNVSWLKTDFNFTTNNGKSYRYCRCFWPQDTAY----FKLNSNYDS 2805
                                    |:.||.||.|:.|.:    .||.....:    :|.|..:|:
Zfish  3012 ------------------------LQDDFGFTLNSNKQH----AFWVGLARFNQYKYKHNLTFDN 3048

  Fly  2806 DSSNFNHNLNG---------NVE-IEVPLATRHRADIVYGLQKRRN------QDAGNVKVVYNEK 2854
                 |.|..|         |:| :.||::.........|::..:.      :|.....::...|
Zfish  3049 -----NENEAGIYTSVDCEANLEFLTVPISIPEIPIPYLGIKTPKINEFSFWEDYRLKDLLTTPK 3108

  Fly  2855 QVLDGKYKRLEQAKAPIYKETTDISLE------NE-VKPLGIHFVSTRDASDPAGSQDVKHIEIY 2912
            |.:|..:|.|.| |.| .|.|.|::||      || .|.|.:||...||           ||   
Zfish  3109 QTIDIDFKLLYQ-KNP-EKHTFDLNLEPIYEAFNENAKILRLHFELGRD-----------HI--- 3157

  Fly  2913 ELRNTQNFNLTGELHSRATLKAQDFKV-VAIHPNR-AVVLSTKYEDVSPEVVRHHSKL------- 2968
                   |:.....:::|.::.:.:|: .:.||.| ..|.......::.||....::|       
Zfish  3158 -------FDALTNSYNQARIQHEKYKIDTSNHPPRYFTVPGYTIPILNIEVSAFRAELPAFGYFI 3215

  Fly  2969 --ELS----ETAWIGY------------------------NLELGNFS-----------KVGNES 2992
              |:|    :|..:|:                        :|.|..|:           ..||.:
Zfish  3216 PKEVSTPSFKTPLLGFSVPSYTLVLPSLALPVLHVPETLRDLTLPTFTIPDIQNNIMIPAFGNLT 3280

  Fly  2993 QSFALEIFYPKRNLSSSGQYY-MTDTNFNSDLS----FQWLGGNYDQQPKIIH----------SN 3042
            ..|:::  .|..:|:|:|..| .:|.....|:|    |..|.|..|....|..          |.
Zfish  3281 YEFSIK--SPVLSLNSNGGLYNHSDMVIKFDVSSTSVFDVLKGKLDGSATINKRRGLKMATSLSL 3343

  Fly  3043 LQWKAEPLHRGDREHRTIALT-------------VAHPLLEKDINCKATYYRG---LRDLLRTHL 3091
            :...||..|..     |::||             :..|:|..|:|   ...||   .:..:.:::
Zfish  3344 VHMCAECSHES-----TVSLTKRNMEASLTNLAKIKCPVLMMDLN---QVLRGNTKSKPNIASNI 3400

  Fly  3092 TIDYSEYPDQLIELGAQLTDRYSELGHTNYTFHVYGKHIASELDVQLNGTLAAMNSYYKTESTAH 3156
            .:.|| |...:||     |.....:.|                    |..|.|::||...||...
Zfish  3401 KVSYS-YDLPIIE-----TQGTGSIDH--------------------NFALEALSSYISLESAWK 3439

  Fly  3157 YKRDIFPARYGKFLALLDVNKRELEYERQSPFHAVRLHLLPTIRYPIYGLNATIWDTPDTNHSGY 3221
            ...|......|...|.|  |.....|...   :.:|..|...:...:|...|..|:. |...:..
Zfish  3440 GTTDSTIMESGNLAASL--NNEVTIYLNA---NGLRSTLKTDVNSKVYHQKAGSWNI-DVTKNLA 3498

  Fly  3222 IYMDILERYARMDFNLTEDAS---------QNLQ-MVGYIP-DTRSAFLDIWRNYEEIRVIDVSS 3275
            :...:...||.|.:..:..||         ||:: .:.::| .|.||.||          ||:|.
Zfish  3499 LEASLRRIYATMAYTSSNAASIASFSTNGKQNVRATLEFVPLTTLSANLD----------IDISQ 3553

  Fly  3276 YLKMNHSRLITG----------RFHWRPSIRQEVREKIQAVGKSVYSSFSEGIDFWIKSIYTETT 3330
            .....|:.::..          ||.|.              ||...::.....|.    |.:.|.
Zfish  3554 PTNYGHAGIVENIDLSITSDKQRFLWS--------------GKEQLATLIHSADL----ILSNTQ 3600

  Fly  3331 ESMGVVWNTAKEYNRDFIDDIGQLSVLEEDLADLRLF--VNQSYEANDFYIKNVVNFTLTILDEL 3393
            ..:.|..:.:.|....|:..| :|.|.::.|.|:..|  |:.:.|...|.:..||.:|.::...|
Zfish  3601 SEIRVEMSESVEGKVAFLKSI-KLPVYQKSLWDIFKFGEVSSTGELQFFNVSTVVIYTKSMEGTL 3664

  Fly  3394 AIRDHIESLPKIFSELWQAMGDSGKALRNSIVWLIETI--------KTTYNNLLDAVARFFHGES 3450
            .      ::|.             |...|.:.:.|..|        ||....:.:...||...:.
Zfish  3665 F------AIPT-------------KLFENGVSFNIPQITFGVPDLFKTIPQMIREVDMRFEEPDL 3710

  Fly  3451 LVYISGLLEKGIAKYDSFIKDLHI-KFIKYIENLWHKTWTLAENHWKAVLKRFEPHLFKMISFIE 3514
            ..|||......|.::......||: .|:..:.||                        ::.:.|.
Zfish  3711 PDYISIPPVITIPEFSIPFTTLHVPTFVIDLTNL------------------------EVPNEIS 3751

  Fly  3515 TTAWNLSKEVFDFIYKRTNELAESPYFNKVSSFTADAERLYRDFKANDAITNIKKYSTIAWNFVK 3579
            |.:       ||.:.         |...||...:.:|...|...|......::.:|......|..
Zfish  3752 TPS-------FDIML---------PGLPKVEIPSINARTKYLKDKMAHLFVSLPQYEITISPFNL 3800

  Fly  3580 EKYFKLVPFGAELNEVLTEIWQ-EIKEL----EKIDQVQIMVQKYYEVMAKVDWVADELQLEHRL 3639
            .|.|.:..:...|:::...::. |:..:    :|||..:|                       .|
Zfish  3801 PKAFDIGDYPIRLDDITNTLYHFELPTIIIPEQKIDVPEI-----------------------SL 3842

  Fly  3640 HQVYGLVRNKFRNYAMNALETADMYREAKTKFVFDPEVGIIDLEQKLPMSWHAFNETPRFEEIPE 3704
            |...|:...||.:.:......:.:|....|..|.:.|.|.:...:....|...|         .|
Zfish  3843 HLPAGVFIPKFGDLSATFKMASPIYNNTWTGNVENTEAGTVCTLKSTCTSTMVF---------LE 3898

  Fly  3705 YQVLA-------------KAQSFFSETNSSIVMK---LYNMRTHLDPKTWLPPYYSRALLIDSRH 3753
            |.:.|             .|:|.|:..:.:|..|   ..|:|...|..:...|         |||
Zfish  3899 YNLDAIATILLENGALGLDAKSTFNHRDMNINWKHDLRQNLRMKRDESSVSRP---------SRH 3954

  Fly  3754 YMTFD---QRYVGLNLNFDELGNGRSTSQCSYLLAHDFFKRNFTLLLEPASKSLAGQGLTRKLSF 3815
            .:..|   |.:..::..:....||.::|..|                 ||: ...|...||:...
Zfish  3955 TLGIDIASQTFSDVSFRYASHNNGITSSVSS-----------------PAA-GFIGFQFTRRSPS 4001

  Fly  3816 IANGQLIEIDLETDHISINGNPQPILPLKLGDVNIHRDLDVLSITSDTEFSLHCNVQFDLCWFEV 3880
            ....:|....|.|.                     .:|.|:||:....:.|...:||.       
Zfish  4002 QFYAKLFSRYLSTS---------------------DKDTDLLSLKMTLKNSEKLSVQV------- 4038

  Fly  3881 SGWYFG-----------RTAGLLGTL----NNEPYDEYTMS--------SGVISN-------ETQ 3915
             |::|.           |...:|..|    |....|...|.        ...:||       |..
Zfish  4039 -GYHFSGLSDMINGLKDRLPSILAALQKFINQYHIDHLGMDINRAALKLKNALSNGIDKAYLEIP 4102

  Fly  3916 LFTDS--WSLKQCRQ--NKL----------AQTQEVSQEVSDACTSFFRTGILATCSAVLDPTPF 3966
            ...|:  .|.:|.:|  ||:          ...||.|:....:...|.||               
Zfish  4103 RMFDATHTSFEQVKQHGNKMWRKMLESFPQDDLQEFSRRFFSSANEFIRT--------------- 4152

  Fly  3967 YEMCM----DLGMKSPPIRKGH-PAVKGACAAALAYIE-----------ACTALKVPMRVPSQCV 4015
            ||..|    |..:|.....|.| |.::........|.:           ..|.....|......:
Zfish  4153 YESNMRALLDAALKFLRNTKFHLPGLEEKLTGQELYNKFREYVSKAIDRVTTRFYSLMEAIVDTI 4217

  Fly  4016 FCQLSNGSYVPEGTFMELSGPEIPK------------------------SSDV---------VFI 4047
            ...::...:...||...:||.:|.|                        |.:|         |:.
Zfish  4218 SGHINKVEFTLPGTTEVISGKKILKDLRSAMKSAKDTIMQAMEEWEKLRSEEVFEDLMNYLKVYT 4282

  Fly  4048 VEAKECNANLKTSK---------------NIMTVVSSIEEQLQAAKITNNRYAVVAFGGVSPYDK 4097
            ..|::...:|||.|               ..:.|:..|.|.::.|||          |.....|.
Zfish  4283 QRAEDFLNSLKTEKLEEISSRVSGIYKEAGNLEVMMKIREWMKEAKI----------GLTELKDF 4337

  Fly  4098 ARSVIYE-HNEFTSKPEQLADYFGHINTGNGSSNDILMAI---------SAAAKLNFRPGVSKTF 4152
            ::.|:.| :|:.:.  |:|          |...||:|||:         |..|.:...|..::.:
Zfish  4338 SKGVVQELYNQMSM--EKL----------NSKLNDLLMAVESYIDSLFKSYLAFMKSLPSYTEPY 4390

  Fly  4153 ILLSCSK 4159
            :.:|..|
Zfish  4391 VRVSNKK 4397

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ApoltpNP_995670.2 LPD_N 49..633 CDD:214755 134/622 (22%)
DUF1943 665..1012 CDD:286281 86/358 (24%)
DUF1081 1029..1122 CDD:283982 21/116 (18%)
VWD 3741..3908 CDD:295339 33/193 (17%)
C8 3951..4014 CDD:285899 12/79 (15%)
apobaXP_694827.7 Vitellogenin_N 39..584 CDD:331790 135/625 (22%)
DUF1943 619..917 CDD:312626 84/351 (24%)
DUF1081 939..1044 CDD:310803 22/116 (19%)
NBD94 <2026..>2549 CDD:330409 98/585 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T128722
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R7740
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.