DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Apoltp and si:dkey-4c23.3

Sequence 1:NP_995670.2 Gene:Apoltp FlyBaseID:FBgn0032136 Length:4333 Species:Drosophila melanogaster
Sequence 2:XP_021325376.1 Gene:si:dkey-4c23.3 ZFINID:ZDB-GENE-050208-668 Length:1553 Species:Danio rerio

Alignment Length:1857 Identity:346/1858 (19%)
Similarity:652/1858 (35%) Gaps:612/1858 (33%)


  Fly    48 GEQLYKYQYTVAVRTEF-------AGSGDNSSDLLLKSDLEIFFPKPCEGYLRINDAKLYDTLDE 105
            |.|.|.|:|...:.:..       ||...||..|::.:|..||.       |::::.:|::    
Zfish    32 GPQTYVYRYEALLFSGLHQKDLARAGIKINSKVLIIAADDNIFL-------LKLSNPQLFE---- 85

  Fly   106 LNDNESDSSEKTKEYDYYDNLANEESESQNYDNMHPK----SSDFNVDLTKNL---LRFAFHDGL 163
                                          |..:.|:    :|.|.::|...|   ::|.:.:|:
Zfish    86 ------------------------------YSGIWPEDTFVTSKFTLELAAQLQIPIKFEYTNGM 120

  Fly   164 ISEVCPQEQETPWVLNIKKGILSAFQNTMMRFDVDANTTETDVSGQCQVQYAL-EDTDSSYVTIR 227
            :.::.........|:|:.:|||:.||..:.:........|..:.|.|:.||.: ||.::::.||.
Zfish   121 VGKLFIPSLVPTIVINLYRGILNIFQLNLKKTQNVYEIQEDGIQGICKTQYVISEDEENNHTTII 185

  Fly   228 KTKDINSCRQRYATHSVLQTTPYTFRDDKTIWPILKSQSHCNLTIDNNVYKEIKCLE-------- 284
            |:||:.||.:|                      |:|.   ..|:     |.| ||:|        
Zfish   186 KSKDLTSCHKR----------------------IMKD---VGLS-----YLE-KCIECQQKIKSY 219

  Fly   285 ------THLLVPFSNASSGALTTSTSRLKLDGVESYSAGEFLEQNPELVERRATLVFDH---TPA 340
                  :::|.|..|..  .:|.:|.|........|..|:..:     :|.|.||.|..   |..
Zfish   220 SGAVTYSYILKPAPNGV--MITEATVREIHQFTPQYEIGDATQ-----METRQTLTFLEIMTTDI 277

  Fly   341 VKPSHD-------EIKAARELL---VEMCRVGFPNIQREFIDVFTNFLQTSKS-------LDYKT 388
            :..|.|       :.:.:.|.|   :::.::.  :.|.:.:|...| |.|.|.       |.|..
Zfish   278 IPISADYLARGTLQYEFSTETLWSPIQLMKIS--DAQAQIVDALNN-LATKKKEVHEDVPLKYIH 339

  Fly   389 LSVLLQRSASTCEQG-----------RNHLLESLPFIGSTASYKVMRDQIINEKLT-KQMAHDWM 441
            |..|::.::....:|           |..:|:::|.:|:.|:.|.::...:..:|: .:.....:
Zfish   340 LIQLMRFASVDAVEGIWSQFKTRPNFRKWILDAIPAVGTLAALKFIKKTFLAGELSFSEFTQVLL 404

  Fly   442 TALSFITRPDEETLETFHSILEYAK---------------NRLDAEYTLGATAVVHSFCKH-HEA 490
            .|:..:| .:.:|::.:.|:..:.|               ..:.|.|..||........|| ||.
Zfish   405 VAVHMVT-ANLDTIKMYSSLALHHKVQETPVLREIAMLGYGTMIARYCSGALECPVELLKHIHEI 468

  Fly   491 CEENLRVQQIINLLETEFLNLYNLFKGERRTRERMVILLKGLGNIGVVSSAFAEQLQWIIR---- 551
            .   .:|....::.|                   :.::||.|||     :|....:::|.:    
Zfish   469 A---TKVSAKADIAE-------------------ITLILKVLGN-----AAHPASIKYITKFLPI 506

  Fly   552 ----EDEAPVDIRLHGIL---AFRRVDCARHRSYFLDNYGNYTLNSELRIYSYLQAMRCPDYISV 609
                ..:.|:.:::..||   |..:.:..:..:..|..:.|..|:.|||:.|::.......  |:
Zfish   507 FGTHIHQFPMRVQVDAILTLKALAKKESKQVLNVVLQLFLNKDLHPELRMLSWIVIFETKP--SM 569

  Fly   610 GVIKSI---LEHEEINQVGSFVWSHLTNLAKSNSP----------VRIEAQGLLLNDELSERFKM 661
            |::.::   |..|:..||.||.:||:..||:|.:|          |.|:    :|:.:|.     
Zfish   570 GLVITLARGLRSEKNLQVSSFAYSHMKALARSTAPDFALIAIACNVAIK----ILSPKLD----- 625

  Fly   662 DIRKFSRNYEHSLFFDEYNF----GTTTDANVIFGTDSYLPRIASVNFTADLFGQSVNFFEFTA- 721
               |.|..|..:...|.|.:    |....|..|....:.|||:......|.|.|.:.:.||.:: 
Zfish   626 ---KLSFLYSKAFLLDGYTYPLMDGAAASAFFINDATTILPRVVVAKVHAYLAGAAADVFEVSSS 687

  Fly   722 ----------RAEGLEELAANAFGPKGPLSGQLLRKKLSFLNRWLGNESAEEDDTLENLLSLDNL 776
                      |.:|::|:              ||  |..|||.       :...|:..|.     
Zfish   688 GDTILLYVGIRTDGIQEV--------------LL--KSPFLNE-------DGQPTIRQLF----- 724

  Fly   777 RLKRKAQEQARASEEEVDEDYDFEESLEGNKRQKRDVSTTRKQEIDRNVDSLGYKLKYDYNNPRA 841
                                    ::|:..|      :.::||.|                   .
Zfish   725 ------------------------QALKSFK------TLSKKQHI-------------------G 740

  Fly   842 QFGLRVFGNDLRYFNVESLVEVMALAAKFNP-------FQQA-KNVLSGKEFTYTKSRVFLDASY 898
            ...:::||.::.:.||:.  .|:..|.:|..       .::| |.:.:|..|.|.|..:..:..:
Zfish   741 SIYIKLFGQEIAFANVDK--AVLEQAIQFTTEGHMVELIEEALKKMQNGIVFQYAKPLLMGEVRH 803

  Fly   899 TVPLAVGLPLAIHAFGASSIDLRVSGNLDE---MDPP------------TDWHFDVEGQFKPSVS 948
            ..|.|.|:|:.:..:.|:.    |:|||:.   :.||            ||  ..|..:..||::
Zfish   804 IFPSAAGVPMELSLYAAAV----VAGNLNVQAIITPPLTELTSVAHLMKTD--VKVTAEISPSIA 862

  Fly   949 VDVITTMQTDMFWEQSGIKVKSNLYSNSELVAKLKVRGRNLVSFSFDLPRD--KNEIFSVRSELL 1011
            :........:..:.|:....:..:::    :..|||.|:      ||:...  |.:.|.:     
Zfish   863 LQAFAVAGINTGFIQAASIARGKIHT----LMPLKVVGK------FDITHANFKLQTFPI----- 912

  Fly  1012 VQKREEQLPQAGIANRSANSTCTWP---VLDQAIGLQMCSHYSVPDLSNATEIYPSLLLAGPLNF 1073
                                  .:|   |..|.:.:..|.|:       .|.:|   |:...|.|
Zfish   913 ----------------------AFPVHAVTAQYVTVHSCLHH-------FTTVY---LINNILCF 945

  Fly  1074 SLILKKSDLSAKKYVFEYKWDQQEEDNNFSLVFTTPGSKVPRVLVANVTKVPDAFNASVAFVNGP 1138
            ........|||...:         ||.|..::..|    :|:::|     |..:.|...:.:: |
Zfish   946 LFNSSFETLSAAGNI---------EDVNAQIIKPT----LPKMVV-----VQSSQNTLTSIIS-P 991

  Fly  1139 NRVSAGCSYD--GNPDFRRLDIYLDTNGNRSLDLGMELRRHQDFTAWI--YNPRMLLAINGVNIT 1199
            ..:|:.....  .:|:.|.:                 :..|:...:.|  ...:..:.:...|..
Zfish   992 GALSSEPVMPPVKDPELRSI-----------------VPVHKTLCSVIPHIGIKTCMEVLSCNAA 1039

  Fly  1200 GLAGTVKVNEKNGIKQH---DVDLSFETKKLQAVIKGNVVQSEITTSTNMTIKYRFQANKIEEIN 1261
            .:..|...|.   |.||   ::::....:..:.::|      ||......|.|.:....|:.|| 
Zfish  1040 FIKNTTLYNM---IGQHGGLELEVQLGARAAKKLLK------EINNVYLKTPKIKTILQKLREI- 1094

  Fly  1262 FAGKLVNNGDKSKTEYRGNMKLQTS-AYPKLNFASEST---WLSLQGHTEGMITYNNAPDYVNPN 1322
            ..|:   ..||| :.:..:.|:|.: :..:.:|:|.|:   .:|....|..::      |.|.| 
Zfish  1095 LEGR---KRDKS-SRFFNHKKIQIAPSSSRRSFSSSSSVHDSISHLSETRSLV------DSVPP- 1148

  Fly  1323 YTSLVRLIFARSHSEDSFLDGTQTRASLELKLPRSKIDYRIL----------------------- 1364
                |..|..|....|..|.|.|..|.::  .|.|::...::                       
Zfish  1149 ----VVAIIGRVVRVDHKLLGYQLTAYVD--RPNSRVQMIVVSIAAKDNWKMCADAVLMSKQTIV 1207

  Fly  1365 ---------VKHKEHIKNGTEH---NVIVGLKYTPEKEITGLFSVHLPRRNLFAIDAYMNVTVPE 1417
                     .|:...||.||.|   :.:|.||...||                         ||.
Zfish  1208 AKMAWGAESPKYAITIKGGTGHHGPSPMVYLKVKCEK-------------------------VPR 1247

  Fly  1418 FNSCTASLKVNEKATKDYIIFINGSWFTGHSVAVKANYKDRSS---RVQALHHLKMIVESPSFNI 1479
            |      :....|:...||  ...:..||.:::.:.|.:.:..   .||.|..|.:|:::|...:
Zfish  1248 F------ITAYSKSVAGYI--PGAAEMTGLTISNEKNIERQIELIILVQDLRTLDIIIKTPLMTL 1304

  Fly  1480 TSLNIIYRRKQLLIFYDIQAKYDQDPYGLTIQ----YASNA------------HNRNTNAEVRL- 1527
            :..|::     |.|....:| |.:|.....||    .||:|            ::|..|.|:.| 
Zfish  1305 SKTNLV-----LPIALPFEA-YPEDNVIKMIQNLYKEASSAKCSKVRSILTTFNHRTYNCEIPLS 1363

  Fly  1528 --KVKERDYWINAK--LLSEQPKLLQLEIHMDKIRDVHIQVGLLNVDKRKELSLELKWDANRDPS 1588
              :|..:|.....|  :|.::..:.:.|:...|:.|:.:|  |...|...::.:.          
Zfish  1364 FYQVLVQDCTSEHKFLILMKKDDVYKHEVLSIKVADIAVQ--LYQQDSVIKVRIN---------- 1416

  Fly  1589 QRLGLLAEYNSPGTKHYDGNLMITYPERTIHFGFNSFTGGPKYFGKVHASWSINEVI----EFE- 1648
                        ||:.....:...:|..|||  ......|..::...|   .:|||.    ::| 
Zfish  1417 ------------GTEVTTDKIPYHHPTGTIH--IEKKGAGIAFYAPGH---GLNEVYYAADQWEI 1464

  Fly  1649 YEAGILPGHT------LHNWVKAELRTPFDGWRVNSL 1679
            |....:.|.|      ....:|.|.|.|::....:|:
Zfish  1465 YVGDRMKGQTRGICEKADGEIKQEYRRPYENLTKSSV 1501

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ApoltpNP_995670.2 LPD_N 49..633 CDD:214755 131/675 (19%)
DUF1943 665..1012 CDD:286281 70/387 (18%)
DUF1081 1029..1122 CDD:283982 19/96 (20%)
VWD 3741..3908 CDD:295339
C8 3951..4014 CDD:285899
si:dkey-4c23.3XP_021325376.1 Vitellogenin_N 34..596 CDD:279663 131/674 (19%)
DUF1943 631..911 CDD:312626 68/375 (18%)
DUF1944 1148..1312 CDD:312629 39/209 (19%)
VWD 1349..1492 CDD:214566 32/172 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23345
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.