DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Apoltp and vtg2

Sequence 1:NP_995670.2 Gene:Apoltp FlyBaseID:FBgn0032136 Length:4333 Species:Drosophila melanogaster
Sequence 2:NP_001038378.1 Gene:vtg2 ZFINID:ZDB-GENE-001201-2 Length:1631 Species:Danio rerio

Alignment Length:1853 Identity:336/1854 (18%)
Similarity:632/1854 (34%) Gaps:513/1854 (28%)


  Fly    49 EQLYKYQYTVAVRTEFAGSGDNSSDLLLKSDLEIFFPKPCEGYLRINDAKLYDTLDELNDNESDS 113
            ::.|.|:|...:.:.....|...:.:.:||.:.:                            |.:
Zfish    27 DKTYVYKYEALLLSGIVQEGLAKAGIQIKSKVLL----------------------------SAA 63

  Fly   114 SEKTKEYDYYDNLANEESESQNYDNMHPKSSDFNVDLTKNL---LRFAFHDGLISEVCPQEQETP 175
            :|.|....:.|.|..|.:.:...|.:.| ::..|..|...|   ::|.:.:|::.:|......:|
Zfish    64 TENTFLLKFVDPLFYEYAGTWPKDQVFP-ATKLNSALAAQLQTPIKFEYANGVVGKVFAPAGVSP 127

  Fly   176 WVLNIKKGILSAFQNTMMRFDVDANTTETDVSGQCQVQYAL-EDTDSSYVTIRKTKDINSCRQRY 239
            .|||:.:|||:..|....:........|....|.|:.||.: ||..:..:|:.|::|::.|::|.
Zfish   128 SVLNLYRGILNILQLNFKKTQNIYELQEAGAQGVCKTQYVISEDPKADRITVTKSRDLSHCQERI 192

  Fly   240 ATHSVLQTTPYTFRDDKTIWPILKSQSHCNLTIDNNVYK---------EIKCLETHLLVPFSNAS 295
            .....|..|.......|.|..::::.::      |.:.|         |....|.|...||:...
Zfish   193 VKDIGLAYTETCVECTKRIKSLIETANY------NYIIKPSDSGALIAEATVKEVHQFSPFNEIH 251

  Fly   296 SGALTTSTSRL-------------KLD----GVESYS-AGEFLEQNPELVERRATLVFDHTPAVK 342
            ..|:..:|..|             |.|    |...|. |.|.|:...:|.:      ..:.||  
Zfish   252 GAAMMEATQSLVFVEFEKAPVVPVKADYMPRGSLQYEFATEILQTPIQLTK------ISNAPA-- 308

  Fly   343 PSHDEIKAARELLVEMCRVGFPNIQREFIDVFTNFLQTSKSLDYKTLSVLLQRSASTCEQG--RN 405
                :||...:.|||      .|:.....|....|:|..:.|...||.......|...::.  |.
Zfish   309 ----QIKEVLKHLVE------NNVAMVHDDAPLKFVQLVQFLRAATLKDTEAIWAQFKDKPVYRR 363

  Fly   406 HLLESLPFIGSTASYKVMRDQIINEKLT-KQMAHDWMTALSFITRPDEETLETFHSILEYAK--- 466
            .||::||.:.:....|.::::.:..:.| .:.....:.||..:. .|.||::...|:..:.|   
Zfish   364 WLLDTLPAVATPVVLKFIKEKFLAGEFTLTEFIPTLVVALQMVP-ADLETIQWTASLALHEKIAT 427

  Fly   467 -NRLDAEYTLGATAVVHSFCKHHEACEENLRVQQIINLLETEFLNLYNLFKGERRTRERMVILLK 530
             ..|.....||..:::..:|.....|...|  .:.|:.:.||.::..::        ..:.:.||
Zfish   428 IPALREVVMLGYGSMIAKYCVAVPTCPAEL--LRPIHEIATEAISKNDI--------PEITLALK 482

  Fly   531 GLGNIGVVSSAFAEQLQWIIR--------EDEAPVDIRLHGILAFRRVDCARHRSYFLDNYG--- 584
            .|||.|..||     |:.|::        ....|:.:::..|||.|.:  |:.....:....   
Zfish   483 VLGNAGHPSS-----LKPIMKLLPVLKTTASALPIRVQVDAILALRSI--AKKEPKLVQPVALQL 540

  Fly   585 --NYTLNSELRIYSYLQAMRCPDYISVGVIKSI---LEHEEINQVGSFVWSHLTNLAKSNSPVRI 644
              ...|:.|||:.:.:.......  ||.|:.|:   |..|...||.||.:||:.:|.:..:|...
Zfish   541 VLERALHPELRMVACILLFETKP--SVAVMSSLAGALRMETNMQVASFAYSHIKSLTRITAPDMS 603

  Fly   645 EAQGL------LLNDELSERFKMDIRKFSRNYEHSLFFDEYNFGTTTDANVIFGTDSYLPRIASV 703
            ...|.      |:|.:|.   :::.| :||.::...:......|....|.:|....:.|||....
Zfish   604 SVAGAANVAIKLMNRKLD---RLNFR-YSRAFQLDFYHTPLMIGAAGSAYMINDAATILPRAVIA 664

  Fly   704 NFTADLFGQSVNFFEFTARAEGLEELAANAFGPKGPLSGQLLRKKLSFLNRWLGNESAEEDDTLE 768
            ...|.|.|.:.:..||..|.||::|...     |.|                             
Zfish   665 KARAYLAGAATDVIEFGLRTEGIQEALL-----KSP----------------------------- 695

  Fly   769 NLLSLDNLRLKRKAQEQARASEEEVDEDYDFEESLEGNKRQKRDVSTTRKQEIDRNVDSLGYKLK 833
                               |::|.||                      |..:|.|.:.:|.....
Zfish   696 -------------------AADESVD----------------------RITKIKRTLRALTNWKA 719

  Fly   834 YDYNNPRAQFGLRVFGNDLRYFNVESLVEVMALAAKFNPFQQA------KNVLSGKEFTYTKSRV 892
            ...|.|.|...::|||.::.:..::..:...||.....|..:|      |.:..|..:...|..:
Zfish   720 MPSNKPLASAYVKVFGQEMAFGRIDKTIIEQALPMVNGPKPRALLKEALKALQEGISWQRAKPLL 784

  Fly   893 FLDASYTVPLAVGLPLAIHAF----GASSIDLRVSGNLDEMDPP---------------TDWHFD 938
            ..:....:|.:||||:.:..:    ||::::::.:     :.||               ||..|.
Zfish   785 VAEVRRILPTSVGLPMELSMYSSVVGAATVNVQAT-----ITPPLPEQIETMTLEQLKKTDVQFK 844

  Fly   939 VEGQFKPSVSVDVITTMQTDMFWEQSGIKVKSNLYSNSELVAKLKVRGR--------NLVSFSFD 995
            .|.  :||:::.....|..:..:.|:.:..:..:    ..:|..||..|        .:.:...:
Zfish   845 AEA--RPSIAIHKFAVMGVNTAFIQAAVMARGKI----RTIAPGKVAARADILKGNYKIEALPVE 903

  Fly   996 LPRDKNEIFSVRSELLVQKREEQLPQAGIANRSANSTCTWPVLDQAIGLQMCSHYSVPDLSNATE 1060
            ||   ..|.|...|.....|:.:.|.|                ::.:.|     .||..|.|.  
Zfish   904 LP---EHIASASFETFAFARDVEDPSA----------------ERTVPL-----VSVLSLQNR-- 942

  Fly  1061 IYPSLLLAGPLNFSLILKKSDLSAKKYVFEYKWDQQEEDNNFSLVFTTPGSKVPRVLVANVTKVP 1125
                             :...||:             |:.:..:...||            .|.|
Zfish   943 -----------------QSQRLSS-------------ENADSEIETETP------------VKAP 965

  Fly  1126 DAFNASVAFVNGPNRVSAGCSYDGNPDFRRLDIYLDTNGNRSLDLGMELRRHQDFTAWIYNPRML 1190
            ..|:.::.:. .|.....||                          :|:..|.  .|:|.|..:.
Zfish   966 APFDRTLCYA-VPYIEIKGC--------------------------VEVHSHN--AAFIRNSTLF 1001

  Fly  1191 LAINGVNITGLAGTVKVNEKNGIKQHDVDLSFETKKLQAVIKG-NVVQSEITTSTNMTIKYRFQA 1254
            ..| |.:....|  |...|...:::.:.::....:..:.:.|. |::..|.....:..:|.|   
Zfish  1002 YII-GQHSARAA--VARAEGPAVEKLEFEVQVGPRAAERLAKQINIIDDETPEGKDFLLKLR--- 1060

  Fly  1255 NKIEEINFAGKLVNNGDKSKTEYRGNMKLQTSAYPKLNFASESTWLSLQGHTEGMITYNNAPDYV 1319
                      :::....|:.|...|:...::|:..:.:.:|.||                     
Zfish  1061 ----------EILETESKNATVSSGSSSSRSSSSSRSSSSSSST--------------------- 1094

  Fly  1320 NPNYTSLVRLIFARSHSEDSFLDGTQTRASLELKLPRSKID-YRILVKHKEHIKNGTEHNVIVGL 1383
             .|.||      :.|.|..|....:.:|.|..|    :|:: :|..  ||:..|  |.|.     
Zfish  1095 -SNSTS------SSSSSSSSSSSMSSSRWSKTL----TKMEAFRKF--HKDQYK--THHG----- 1139

  Fly  1384 KYTPEKEITGLFSVHLPRRNLFAIDAYMNVTVPE-FNSCTASLKVNEKATKDYIIFINGSWFTGH 1447
             .:.....||.....:.:::     .|:..|||. |.....:::|:.|        :.|..|.  
Zfish  1140 -DSKSSRSTGSSLEQIQKQS-----RYLGNTVPPVFAIIARAVRVDRK--------LLGYQFV-- 1188

  Fly  1448 SVAVKANYKDRSSRVQALHHLKMIVESPSFNITSLNIIYRRKQLL--IFYDIQAKYDQDPYGLTI 1510
                 |.:...|||||.:  ...|.|:.:|...:..::..:.::.  :.:..:.|    .|.:| 
Zfish  1189 -----AFFDKPSSRVQFI--ASSIAENDNFKFCADGVLLSKHKVTSKVTWGAECK----EYAVT- 1241

  Fly  1511 QYASNAHNRNTNAEVRLKVKERDYWINAKLLSEQPKLLQLEIHMDKIRDV----------HIQVG 1565
                      |.||             |.||.|.| ..:||...:::..:          ||.:.
Zfish  1242 ----------TKAE-------------AGLLGEFP-AFRLEWEWERLPIIFTTYAKKLSKHIPMA 1282

  Fly  1566 LL----NVDKRKELSLELKWDANRDPSQRLGLLAEYNSPGTKHYDGNLMITYPER-----TIHFG 1621
            .|    ||::.|....||:........:.|.::...........|..|.:|:|..     .:||.
Zfish  1283 ALQAGFNVERAKNSEKELELTVALPSKRTLNVIVRVPEMTMSRMDIPLPVTFPINPDGTFDVHFY 1347

  Fly  1622 FNSFTGGPKY---FGKVHASWSINEVIEFEYEAGILPGHTLHNWVKAELRTPFDGWRVNSLDAGI 1683
            .:.:.....|   :.....|...:.:..|.           :...|.|:  |...::|.:.|. .
Zfish  1348 EDIYFRAQNYIYDYTTAQCSMMQDTISTFN-----------NKTYKNEM--PISCYQVLAQDC-T 1398

  Fly  1684 YSLKNLILVNSTLFWADDQKLQVGYK-SDYDVNDQLMSFDVRFGINSTIRDIPTINVKVKH---W 1744
            ..||.:.|:...   .:.:|..:..| .|.|::...:..|.:..||..  ::|..::..:|   .
Zfish  1399 SELKFVALLKKD---EESEKTHLNVKLVDIDIDLYTLGTDAKVKINGL--EVPISSLPYQHPSGS 1458

  Fly  1745 MDVKKVDTELYLGYSGQNDTFNTYSMDSSWEIE 1777
            :.:::....|.| |:........|..:..|:|:
Zfish  1459 IQIREKADGLSL-YAPSLGLHEVYFANGDWKIQ 1490

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ApoltpNP_995670.2 LPD_N 49..633 CDD:214755 132/638 (21%)
DUF1943 665..1012 CDD:286281 66/380 (17%)
DUF1081 1029..1122 CDD:283982 10/93 (11%)
VWD 3741..3908 CDD:295339
C8 3951..4014 CDD:285899
vtg2NP_001038378.1 Vitellogenin_N 24..592 CDD:279663 132/638 (21%)
DUF1943 626..917 CDD:286281 67/381 (18%)
DUF1944 1167..1331 CDD:286284 38/210 (18%)
VWD 1362..1519 CDD:214566 25/150 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23345
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.