DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Apoltp and vtg1

Sequence 1:NP_995670.2 Gene:Apoltp FlyBaseID:FBgn0032136 Length:4333 Species:Drosophila melanogaster
Sequence 2:NP_001038362.3 Gene:vtg1 ZFINID:ZDB-GENE-001201-1 Length:1362 Species:Danio rerio

Alignment Length:1591 Identity:285/1592 (18%)
Similarity:547/1592 (34%) Gaps:442/1592 (28%)


  Fly   111 SDSSEKTKEYDYYDNLANEESESQNYDNMHPKSSDFNVDLTKNL-------LRFAFHDGLISEVC 168
            |.::|.|......|.|..|.:.:...|...|.:.     ||..|       ::|.:.:|::.:|.
Zfish    61 SATTENTYLMKLMDPLLYEYAGTWPKDPFVPATK-----LTSALAAQLQIPIKFEYANGVVGKVF 120

  Fly   169 PQEQETPWVLNIKKGILSAFQNTMMRFDVDANTTETDVSGQCQVQYAL-EDTDSSYVTIRKTKDI 232
            .....:|.|:|:.:|||:..|..:.:........|....|.|:..|.: ||..::::.:.|:||:
Zfish   121 APAGVSPTVMNLHRGILNILQLNLKKTQNIYEMQEAGAQGVCRTHYVINEDPKANHIIVTKSKDL 185

  Fly   233 NSCRQRYATHSVLQTTPYTFRDDKTIWPILKSQSHCNLTIDNNVYKEIKCLETHLLVPFSNASSG 297
            :.|::|......|..|.......:.:..::::.::                 .:::.|   |.:|
Zfish   186 SHCQERIMKDVGLAYTERCAECTERVKSLIETATY-----------------NYIMKP---ADNG 230

  Fly   298 ALTTSTSRLKLDGVES-YSAGEFLE-QNPELVERRATLVF---DHTPAVKPSHD-------EIKA 350
            ||....:      ||. |....|.| ....::|.:.||.|   :.||.|....|       :.:.
Zfish   231 ALIAEAT------VEEVYQFSPFNEIHGAAMMEAKQTLAFVEIEKTPVVPIKADYMPRGSLQYEF 289

  Fly   351 ARELL---VEMCRVGFPNIQREFIDVFTNFLQTSKSL-----DYKTLSVLLQRSASTCEQ----- 402
            |.|:|   :::.::.  :...:.::|..:.:..:|.:     .:|.:.::.....::.|:     
Zfish   290 ATEILQTPIQLMKIS--DAPAQIVEVLKHLVSNNKDMVHDDAPFKFVQLVQLLRVASLEKIEAIW 352

  Fly   403 --------GRNHLLESLPFIGSTASYKVMRDQII-NEKLTKQMAHDWMTALSFITRPDEETLETF 458
                    .|..||::||.:|:....|.::::.: .|..|.:.....:.||..:| .|.||::..
Zfish   353 SQFKDKPVYRRWLLDALPAVGTPVIIKFIKEKFLAGEFTTPEFIQTLVIALQMVT-ADPETIKMT 416

  Fly   459 HSILEYAK----NRLDAEYTLGATAVVHSFCKHHEACEENLRVQQIINLLETEFLNLYNLFKGER 519
            .|:..:.|    ..|.....||..:::..:|.....|...|  .:.|:.:.||.::..::     
Zfish   417 ASLATHEKFATIPALREVVMLGYGSLIAKYCVAVPTCPAEL--LRPIHEIATEAISKNDI----- 474

  Fly   520 RTRERMVILLKGLGNIGVVSSAFAEQLQWIIR--------EDEAPVDIRLHGILAFRRVDCARHR 576
               ..:.:.||.:||.|..||     |:.|::        .:..|:.:::..|||.|.:.....:
Zfish   475 ---PEITLALKVMGNAGHPSS-----LKPIMKLLPGLRTAANALPIRVQVDAILALRNIAKKEPK 531

  Fly   577 -------SYFLDNYGNYTLNSELRIYSYLQAMRC-PDYISVGVIKSILEHEEINQVGSFVWSHLT 633
                   ...||.    .|:.|:|:.:.:..... |....|..:...|..|....|.||.:||:.
Zfish   532 LVQPVALQLVLDR----ALHPEVRMVACIVLFEAEPSVALVSSLAGALRIEPNMHVASFAYSHIK 592

  Fly   634 NLAKSNSPVRIEAQGLLLNDELSERFKMDIRKFSR-NYEHSLFFD-EYNF-----GTTTDANVIF 691
            :|.:..:|......|     ..:...|:..||..| ||.:|..|. :|.:     |....|.:|.
Zfish   593 SLTRITAPDMASVAG-----AANVAIKLMSRKLDRLNYRYSRAFQMDYYYTPLMIGAAGSAYMIN 652

  Fly   692 GTDSYLPRIASVNFTADLFGQSVNFFEFTARAEGLEELAANAFGPKGPLSGQLLRKKLSFLNRWL 756
            ...:.|||.......|.|.|.:.:..||..|..|:.|...     |.|                 
Zfish   653 DAATILPRAVVAKARAYLAGAAADVIEFGVRTGGIHEALL-----KSP----------------- 695

  Fly   757 GNESAEEDDTLENLLSLDNLRLKRKAQEQARASEEEVDEDYDFEESLEGNKRQKRDVSTTRKQEI 821
                                           |::|..|.       :...||..|.::..:....
Zfish   696 -------------------------------AADESADR-------ITKIKRTLRALTNWKALPT 722

  Fly   822 DRNVDSLGYKLKYDYNNPRAQFGLRVFGNDLRYFNVESLV--EVMALAAKFNPFQQAKNVL---- 880
            |:               |.|...|:|||.::.|.|.:..:  |.:.:|....|....|..|    
Zfish   723 DK---------------PLASAYLKVFGQEVAYVNFDKTIIEEAIPMATGPKPRALLKEALKALQ 772

  Fly   881 SGKEFTYTKSRVFLDASYTVPLAVGLPLAIH----AFGASSIDLRVS------GNLDEMD----P 931
            .|..|.|.|..:..:....:|.|||:|:...    |..|:|::::.:      ..|:.|.    .
Zfish   773 EGVAFQYAKPLLAAEVRRILPTAVGVPMEFSWYTAAVAAASVNVQATITPALPEKLESMTYEQLK 837

  Fly   932 PTDWHFDVEGQFKPSVSVDVITTMQTDMFWEQSGIKVKSNLYSNSELVAKLKVRGR--------- 987
            .||..|..|.  :|||::.....|..:..:.|:.:..:..:    ..:|..||..|         
Zfish   838 KTDVQFQAEA--RPSVALQTFAVMGVNTAFIQAAVMARGKI----RTIAPGKVAARADILKGNYK 896

  Fly   988 ----------NLVSFSFD---LPRDKNEIFSVRSELLVQKREEQLPQAGIANRSANSTCTWPVLD 1039
                      ::.|.||:   :.|:..:..:.||..||.:...|..||..|.             
Zfish   897 VEALPVELPEHIASASFETYAVVRNIEDHSAERSVPLVPELSLQNSQASYAG------------- 948

  Fly  1040 QAIGLQMCSHYSVPDLSNATEIYPSLLLAGPLNFSLILKKSDLSAKKYVFEYKWDQQEEDNNFSL 1104
                          |||:......|:....|.:.:|..      |..|: |.|...:...:|.:.
Zfish   949 --------------DLSSEMSSVASVRAPAPFDRTLCY------AVPYI-EIKGCVEVHSHNAAF 992

  Fly  1105 VFTTPGSKVPRVLVANVTKVPDAFNASVAFVNGPNRVSAGCSYDGNPDFRRLDIYLDTNGNRSLD 1169
            :                      .|:::.::.|.:.|.|..:....|...||:..:.. |.|:.:
Zfish   993 I----------------------RNSTLFYIIGHHSVRAAVARAEGPAVERLEFEVQV-GPRAAE 1034

  Fly  1170 LGMELRRHQDFTAWIYNPRMLLAINGVN---ITGLAGTVKVNEKNGIKQHDVDLSFETKKLQAVI 1231
                              |::..||.::   ..|.|..:|:.|                .|....
Zfish  1035 ------------------RLVKQINIIDDDTPEGQAFLLKLRE----------------ILDTEA 1065

  Fly  1232 KGNVVQSEITTSTNMTIKYRFQANKIEEINFAGKLVNNGDKSKTEYRGNMKLQTSAYPKLNFASE 1296
            |...|.||.::|.|.                               |.:....||.....:.:|.
Zfish  1066 KNAPVSSESSSSRNS-------------------------------RSSSSRSTSTSTSSSSSSS 1099

  Fly  1297 STWLSLQGHTEGMITYNNAPDYVNPNYTSLVRLIFARSHSEDSFLDGTQTRASLELKLPRSKIDY 1361
            |:..|....:......:.....:.|         |.:.| :|.:|  ....|:.:.....:...:
Zfish  1100 SSSSSSSSSSMSSSRMSKTATIIEP---------FRKFH-KDRYL--AHHSATKDTSSGSAAASF 1152

  Fly  1362 RILVKHKEHIKNGTEH-NVIVGLKYTPEKEITGLFSVHLPRRNLFAIDAYMNVTVPEFNSCTASL 1425
            ..:.|....:.|.... ..|:......::::.|           :.:.||.:..........:|:
Zfish  1153 EQMQKQNRFLGNDIPPVFAIIARAVRADQKLLG-----------YQLAAYFDKPTARVQLIVSSI 1206

  Fly  1426 KVNEKATKDYIIFINGSWFTGHSVAVKANY--KDRSSRVQALHHLKMIVESPSFNITSLNIIYRR 1488
            ..|:...    |..:|:..:.|.|..|.::  :.:...|.|.....::.|.|:   ..|.:.:.|
Zfish  1207 AENDNMK----ICADGALLSKHKVTGKFSWGAECKQYAVFAKAEAGVLGEFPA---ARLEVEWER 1264

  Fly  1489 KQLLIF--------YDIQAKYDQDPYGLTIQYASNAHNRNTNAEVRLKVKERDYWINAKLLSEQP 1545
            ..:::.        :.:.|.||.   |...:.|:|:              |::..:.|.|.|:  
Zfish  1265 LPIIVTTYAKKLGKHILTAAYDT---GFRFERATNS--------------EKEIELTAALPSQ-- 1310

  Fly  1546 KLLQL-----EIHMDKIRDVHIQVGL-LNVD 1570
            :.|.:     ||.|.| ||:::.|.: :|.|
Zfish  1311 RSLNIIARIPEITMSK-RDIYLPVAVPINPD 1340

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ApoltpNP_995670.2 LPD_N 49..633 CDD:214755 113/584 (19%)
DUF1943 665..1012 CDD:286281 77/396 (19%)
DUF1081 1029..1122 CDD:283982 11/93 (12%)
VWD 3741..3908 CDD:295339
C8 3951..4014 CDD:285899
vtg1NP_001038362.3 Vitellogenin_N 24..592 CDD:279663 113/584 (19%)
DUF1943 626..917 CDD:286281 69/372 (19%)
DUF1944 1168..1332 CDD:286284 34/202 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR23345
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.