DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Apoltp and vtg6

Sequence 1:NP_995670.2 Gene:Apoltp FlyBaseID:FBgn0032136 Length:4333 Species:Drosophila melanogaster
Sequence 2:NP_001116082.3 Gene:vtg6 ZFINID:ZDB-GENE-001201-5 Length:1374 Species:Danio rerio

Alignment Length:1073 Identity:202/1074 (19%)
Similarity:389/1074 (36%) Gaps:269/1074 (25%)


  Fly   111 SDSSEKTKEYDYYDNLANEESESQNYDNMHPKSSDFNVDLTKNL-------LRFAFHDGLISEVC 168
            |..:|.|......|.|..|.:.:...|:..|.:.     ||..|       ::|.:.:|::.:|.
Zfish    72 SAMTENTYLMKLMDPLLYEYAGTWPKDSFVPATK-----LTSALAAQLQIPIKFEYANGVVGKVF 131

  Fly   169 PQEQETPWVLNIKKGILSAFQNTMMRFDVDANTTETDVSGQCQVQYAL-EDTDSSYVTIRKTKDI 232
            .....:|.|:|:.:|||:..|..:.:........|....|.|:..|.: ||..::::.:.|:||:
Zfish   132 APAGVSPTVMNLHRGILNILQLNLKKTQNIYELQEAGAQGVCRTHYVINEDPKTNHIIVTKSKDL 196

  Fly   233 NSCRQRYATHSVLQTTPYTFRDDKTIWPILKSQSHCNLTIDNNVYKEIKCLETHLLVPFSNASSG 297
            :.|::|......|..|.......|.:..::::.::                 .:::.|   |.:|
Zfish   197 SHCQERIMKDVGLAYTERCAECTKRVKSLIETATY-----------------NYIMKP---ADNG 241

  Fly   298 ALTTSTSRLKLDGVES-YSAGEFLE-QNPELVERRATLVF---DHTPAVKPSHD-------EIKA 350
            ||....:      ||. |....|.| ....::|.:.||.|   :.||.|....|       :.:.
Zfish   242 ALIAEAT------VEEVYQFSPFNEIHGAAMMEAKQTLAFVEIEKTPVVPIKADYMPRGSLQYEF 300

  Fly   351 ARELL---VEMCRVGFPNIQREFIDVFTNFLQTSKSL-----DYKTLSVLLQRSASTCEQ----- 402
            |.|:|   :::.::  .:...:.::|..:.::.:|.:     .:|.:.::......|.::     
Zfish   301 ASEILQTPIQLMKI--KDAPAQIVEVLKHLVENNKDMVHDDAPFKFVQLVQLLRVVTLDKIEAIW 363

  Fly   403 --------GRNHLLESLPFIGSTASYKVMRDQII-NEKLTKQMAHDWMTALSFITRPDEETLETF 458
                    .|..||::||.:|:....|.::::.: .|..|.:.....:.||..:| .|.||::..
Zfish   364 SQFKDKPVYRRWLLDALPAVGTPVIIKFIKEKFLAGEFTTPEFIQTLVIALQMVT-ADLETIQMT 427

  Fly   459 HSILEYAK----NRLDAEYTLGATAVVHSFCKHHEACEENLRVQQIINLLETEFLNLYNLFKGER 519
            .|:..:.|    ..|.....||..:::...|.....|...|  .:.|:...||.::..::     
Zfish   428 ASLAMHEKFVSIPALREVVMLGYGSLIAKHCVAVPTCPAEL--LRPIHETATEAISKNDI----- 485

  Fly   520 RTRERMVILLKGLGNIGVVSSAFAEQLQWIIR--------EDEAPVDIRLHGILAFRRVDCARHR 576
               ..:.:.||.:||.|..||     |:.|::        .:..||.:::..|||.|.:.....:
Zfish   486 ---PEITLALKVMGNAGHPSS-----LKPIMKLLPGLRTAANALPVRVQVDAILALRNIAKKEPK 542

  Fly   577 -------SYFLDNYGNYTLNSELRIYSYLQAMRCPDYISVGVIKSI---LEHEEINQVGSFVWSH 631
                   ...||.    .|:.|:|:.:.:.......  ||.:|.|:   |..|....|.||.:||
Zfish   543 LVQPVALQLVLDR----ALHPEVRMVACIVLFETEP--SVALISSLAGALRTEPNMHVASFAYSH 601

  Fly   632 LTNLAKSNSPVRIEAQGL------LLNDELSERFKMDIRKFSRNYEHSLFFDEYNFGTTTDANVI 690
            :.:|.:..:|......|.      |:|.:|.   :::.| :||.::...::.....|....|.:|
Zfish   602 IK
SLTRITAPDMAYVAGAANVAIKLMNCKLD---RLNYR-YSRAFQMDYYYTPLMIGAAGSAYMI 662

  Fly   691 FGTDSYLPRIASVNFTADLFGQSVNFFEFTARAEGLEELAANAFGPKGPLSGQLLRKKLSFLNRW 755
            ....:.|||.........|.|.:.:..||..|..|:.|...     |.|                
Zfish   663 NDAATILPRAVVAKARTYLAGAAADVVEFGVRTGGINEALL-----KSP---------------- 706

  Fly   756 LGNESAEEDDTLENLLSLDNLRLKRKAQEQARASEEEVDEDYDFEESLEGNKRQKRDVSTTRKQE 820
                                            |::|.||                      |..:
Zfish   707 --------------------------------AADESVD----------------------RITK 717

  Fly   821 IDRNVDSLGYKLKYDYNNPRAQFGLRVFGNDLRYFNVESLVEVMALAAKFNPFQQA------KNV 879
            |.|.:.:|........:.|.|...::|||.::.|.|.:..:...|:.....|..:|      |.:
Zfish   718 IKRTLKALTNWKALPTDKPLASAYVKVFGQEVAYVNFDKTIIEEAIPMVTGPKPRALLKEALKAL 782

  Fly   880 LSGKEFTYTKSRVFLDASYTVPLAVGLPLAIH----AFGASSIDLRVS------GNLDEMD---- 930
            ..|..|.|.|..:..:....:|.|||:|:...    |..|:|::::.:      ..|:.|.    
Zfish   783 QEGVAFQYAKPLLAAEVRRILPTAVGVPMEFSWYTAAVAAASVNVQATITPALPEKLESMTYEQL 847

  Fly   931 PPTDWHFDVEGQFKPSVSVDVITTMQTDMFWEQSGIKVKSNLYSNSELVAKLKVRGR-------- 987
            ..||..|..|.  :|||::.....|..:..:.|:.:..:..:    ..:|..||..|        
Zfish   848 KKTDVQFQAEA--RPSVALQTFAVMGVNTAFIQAAVMARGKI----RTIAPGKVAARADILKGNY 906

  Fly   988 NLVSFSFDLPRDKNEIFSVRSELLVQKREEQ--------LPQAGIANRSANSTCTWPVLDQAIGL 1044
            .:.:...||| :.....|..:..:|:..|:.        :||..:.|...::...|         
Zfish   907 KVEALPVDLP-EHIASASFETHA
VVRNIEDHSAERSVPLVPQLSLQNSQTSNANDW--------- 961

  Fly  1045 QMCSHYSVPDLSNATEIYPSLLLAGPLNFSLIL 1077
                         ::|:.|.:.:..|..|...|
Zfish   962 -------------SSEMSPDVSVKAPAPFDRTL 981

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ApoltpNP_995670.2 LPD_N 49..633 CDD:214755 117/586 (20%)
DUF1943 665..1012 CDD:286281 67/375 (18%)
DUF1081 1029..1122 CDD:283982 6/50 (12%)
VWD 3741..3908 CDD:295339
C8 3951..4014 CDD:285899
vtg6NP_001116082.3 Vitellogenin_N 35..603 CDD:279663 117/586 (20%)
DUF1943 637..928 CDD:286281 68/374 (18%)
DUF1944 1182..1346 CDD:286284
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23345
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.