DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Apoltp and si:dkeyp-106c3.1

Sequence 1:NP_995670.2 Gene:Apoltp FlyBaseID:FBgn0032136 Length:4333 Species:Drosophila melanogaster
Sequence 2:XP_021322449.1 Gene:si:dkeyp-106c3.1 ZFINID:ZDB-GENE-050411-73 Length:2992 Species:Danio rerio

Alignment Length:4253 Identity:781/4254 (18%)
Similarity:1370/4254 (32%) Gaps:1553/4254 (37%)


  Fly    27 LKDPRICGRPQC-DSKSAKFNYGEQLYKYQYTVAVRTEFAGSGDNSSDLLLKSDLEIFFPKPCEG 90
            |:..::| :|.| |.:..      |.:.|:|:..:.:.:.||....|.|.|...::|.....|. 
Zfish    29 LQQGQLC-KPACPDVQKG------QRHTYRYSTTISSTWKGSSSGGSQLALDCVIDINVRPGCP- 85

  Fly    91 YLRINDAKLYDTLDELNDNESDSSEKTKEYDYYDNLANEESESQNYDNMHPKSSDFNVDLTKNLL 155
                      |.:.:|.                 |:..::|.|:. ||...:..:....|.||.|
Zfish    86 ----------DMMLKLR-----------------NIQIKQSSSKR-DNSVQRLKNMRESLEKNPL 122

  Fly   156 RFAFHDGLISEVCPQEQETPWVLNIKKGILSAFQNTMMRFDVDANTTETDVSGQCQVQYALEDTD 220
            ||:...|.::..||||.|..|.||||:.|||..| |...........||||.|.|...|  |...
Zfish   123 RFSLEGGKVTMFCPQEAEQVWTLNIKRSILSMIQ-TSHSGRARETVRETDVYGTCTSSY--ERRG 184

  Fly   221 SSYVTIRKTKDINSCR-QRYATHSVLQTTPYTFRDDKTIWPILKSQSHCNLTIDNNVYKEIKCLE 284
            .|.|.||..:...|.| .::...||      ..::|.|:    .:...|....|:.|.|::.|.|
Zfish   185 PSLVKIRNLQLCLSDRIDQFWRSSV------PLKEDMTV----SAGLTCVQLYDDTVLKKVNCTE 239

  Fly   285 THLLVPF---------SNASSGALTTSTSRLKLDGVESYSAGEFLEQNPELVERRATLVFD---- 336
            |..|||.         ...||..|..:...:.:|          |.||...:   :::||:    
Zfish   240 TVSLVPLPGLLEVTETKTVSSLTLLRTLDVIPMD----------LAQNTGYL---SSIVFEAEGQ 291

  Fly   337 ----HTPAVKPSHDEI-KAARELLVEMCRVGFPNIQREFIDVFTNFLQTSKSLDYKTLSVLLQRS 396
                |   ..||..|: ...|.|...:..      |::..::..|.:...::|..:.|..|...:
Zfish   292 SSGRH---AGPSVQEVSNIVRRLCAHLMD------QQQQSELLLNLVLQLRALSSRQLRDLWHEA 347

  Fly   397 ASTCEQGRNHLLESLPFIGSTASYKVMRDQIINEKLTKQMAHDWMTALSFITRPDEETLETFHSI 461
            :..|......|:::|...|:.....|..|.|:|:::.::..   :..:||.:.|....:....::
Zfish   348 SFKCRDDWQPLVDALSACGTENCILVNADLILNKEVDQEHI---LPLISFASHPTPSIISHLSAL 409

  Fly   462 LEYAKNRLDAEYTLGATAVVHSFCKHHEACEENLRVQQIINLLE---------------TEFLNL 511
            |:....|  .:..|..:::||.||: ...|.|...|||.::||:               ||.|: 
Zfish   410 LQIPLIR--PKVLLVVSSLVHRFCQ-QSPCSEISEVQQFVHLLKLSLEAGCQVDDHLKITELLH- 470

  Fly   512 YNLFKGERRTRERMVILLKGLGNIGVVSSAFAEQLQWIIREDEAPVDIRLHGILAFRRVDCARHR 576
                            :||.:.|.|...|.....|...::....|::::|..|.||||:.|.:.|
Zfish   471 ----------------VLKAVENAGAAVSDLIPTLSRCVQNHSVPLELQLAAIRAFRRIPCHQDR 519

  Fly   577 SYFLDNYGNYTLNSELRIYSYLQAMRCPDYISVGVIKSILEHEEINQVGSFVWSHLTNLAKSNSP 641
            ......:.....|.|:||.:|.|.|.||:.....::|:.|.:|:.:||||||||||.|:.|:..|
Zfish   520 KVLAQVFQRQQENVEVRIAAYQQLMHCPNQEIFTLVKTTLSNEKSSQVGSFVWSHLFNIQKTEDP 584

  Fly   642 VRIEAQGLLLNDELSERFKMDIRKFSRNYEHSLFFDEYNFGTTTDANVIFGTDSYLPRIASVNFT 706
            ::......|.:|.:|..|:.:..|:|.:.::::  |........:..::|...|:||..|..|.|
Zfish   585 LKKYLMESLPDDIISRDFEAEPWKYSSHMDYTV--DTGVAAANVEGALVFSPQSFLPSYAMANLT 647

  Fly   707 ADLFGQSVNFFEFTARAEGLEELAANAFGPKGPL-----SGQLLRKKLSFLNRWLGNESAEEDDT 766
            ..:.|::.|..|.:.|.|.||.|....| .:.||     ||                .||:.|. 
Zfish   648 VFILGRAFNLLEISLRMENLEPLLKTVF-EQQPLASADHSG----------------PSAQADS- 694

  Fly   767 LENLLSLDNLRLKRKAQEQARASEEEVDEDYDFEESLEGNKRQKRDVSTTRKQEIDRNVDSLGYK 831
                       :|:|    .|.|..:..:...|     .:.|.|    .|.:::.||.:      
Zfish   695 -----------VKKK----ERNSNSDGCQSATF-----SSMRTK----FTEQRKKDRTL------ 729

  Fly   832 LKYDYNNPRAQFGLRVFGNDLRYFNVESLVEVMALAAKFNPFQQ---------AKNVLSGKEFTY 887
                    .....:::||||:.:...:.|          :.:|:         ...:|.|:|...
Zfish   730 --------HCWINVKMFGNDMTFMTCDDL----------HSYQRKLSLSTAGVVVKLLKGQEIKL 776

  Fly   888 TKSRVFLDASYTVPLAVGLPLAIHAFGASSIDLRVSGNLDEMDPPTDW-HFDVEGQFKPSVSVDV 951
            ::..|.|.....:|...|||:.:....::...||:.|    :....:| ||.:.|..|||..|.:
Zfish   777 SQKPVVLAEELVLPSLSGLPMRLSINMSALFSLRLKG----ISNYKNWSHFSLAGYIKPSALVGI 837

  Fly   952 ITTMQTDMFWEQSGIKVKSNLYSNSELVAKLKV-RGRNLVSFSFDLPRDKNEIFS---------- 1005
            ......|....:.|::..:.|.:::.|...:.: .|:|| ....:.|.|..:|.:          
Zfish   838 SVRAGVDGAIGRVGLEWVTQLKTSTSLDGAVYLHHGQNL-KLVLNTPEDVMDILTFNSRVFRVSG 901

  Fly  1006 -VRSELLVQKREEQLPQAGIANRSANSTCTWPVLDQAIGLQMCSHYSVPDLSNATEIYPSLLLAG 1069
             ::.||:|.:           |....:|||.....:.:|.|:||..:.| |:...:.:|.|   |
Zfish   902 DLKDELVVTR-----------NLKEKNTCTPKTWSKMVGWQLCSDLTYP-LTLMGKSFPPL---G 951

  Fly  1070 PLNFSLILKKSDLSAKKYVFE--YKWDQQEE-----DNNFSLVFTTPGSKVPRVLVANVTKVPDA 1127
            |:.|:|.|:|.|....:|:.|  |.:..|..     :....|...||.|.:.|            
Zfish   952 PVIFTLRLQKLDKGLNQYLLEAAYTFVSQRHFWMPLEATLLLFIGTPQSTIHR------------ 1004

  Fly  1128 FNASVAFVNGPNRVSAGCSYDGNPDFRRLDIYLDTNGNRSLDLGMELRRHQDFTAWIYNPRMLLA 1192
                                         |:.||.|                    :...|::|.
Zfish  1005 -----------------------------DVSLDVN--------------------LTPKRLILK 1020

  Fly  1193 INGVNITGLAGTVKVNEKNGIKQHDVDLSFETKKLQAVIKGNVVQSEITTSTNM----------T 1247
            |                              |..|:|::    :|:::....|.          .
Zfish  1021 I------------------------------THPLKAIL----IQAQLEEINNQRSGRIELLIDN 1051

  Fly  1248 IKYRFQANKIEEINFAGKLVNNGDKSKTEYRGNMKLQTSAYPKLNFASESTWLSLQGHTEGMITY 1312
            |.:.|....:|.:|.|.::       :|.:..:.|:....:|          .||..:|    |:
Zfish  1052 IHHYFIKGLLETVNLASEM-------RTHFHLDAKVVADGHP----------FSLSVNT----TH 1095

  Fly  1313 NNAPDYVNPNYTSLVRLIFARSHSEDSFLDGTQTRASLELKLPRSKIDYRILVKHKEHIKNGTEH 1377
            ..:..:|   ..:|::.:|.:.             ||..::|.||             :::|..|
Zfish  1096 ARSRKFV---IQALLKNVFNKD-------------ASFSVQLERS-------------LEDGRRH 1131

  Fly  1378 NVIVGLKYTPEKEITGLFSVHLPRRNLFAIDAYMNVTVPEFNSCTASLKVNEKATKDYIIFINGS 1442
                                       ::|||  ...:|...|......:.::.::         
Zfish  1132 ---------------------------YSIDA--GFLLPSAVSLRGLGLLKQRGSE--------- 1158

  Fly  1443 WFTGHSVAVKANY--KDRSSRVQALHHLKMI-VESPS---FNITSLNIIYRRKQLLIFYDIQAKY 1501
            |    |.||:..|  |:...::|..|..:.: .||.|   :.:|:.:.::..:.:.:.:.|..|:
Zfish  1159 W----SSAVRVRYGVKEDLEKMQECHMTQNLHSESDSIQTYRVTAAHELHCSQFINLNHKILFKH 1219

  Fly  1502 DQDP----------YGLTIQYASNAHN-------RNTN--------AEVRLKVKERDYWINAKLL 1541
            ::.|          ||.....:||.|.       ||.:        .|:.|::.:|......:||
Zfish  1220 ERSPVHVQSSLDISYGKQWNQSSNKHRILFNQSLRNQSGPDLTSYAVELSLRLLDRGQNYRTQLL 1284

  Fly  1542 SEQPKLLQLEIHMDKIRDVHIQVGLLNVDKRKELSLELKWDANRDPSQRLGLLAEYNSPGTKHYD 1606
            ....|..:.|      ...|:::   |.:.:..|...:.|   :|.|.:..|         :.::
Zfish  1285 HNNFKTQKSE------SSTHLKI---NYNNQMPLIAGVHW---KDVSTKTSL---------QKWE 1328

  Fly  1607 GNLMITYPERTIHFGFNSFTGGPKYFGKVHASWSINEVIEFEYEAGILPGHTLHNWVKAELRTPF 1671
            |:..:..|                        |                   |:.:...:|..|.
Zfish  1329 GSFNMDTP------------------------W-------------------LYVYAAQKLAQPQ 1350

  Fly  1672 DGWRVNSLDAGIYSLKNLILVNSTLFWADDQKLQVGYKSDYDVNDQLMSFDVRFGINSTIRDIPT 1736
            .|....|.:.....|.|:..|....|:.|..|.:.|         ||..|            .||
Zfish  1351 RGITQFSSEVTTRKLVNIRGVTLEGFYKDRGKERQG---------QLHLF------------TPT 1394

  Fly  1737 IN-VKVKHWMDVKKVDTELYLGYSGQNDTFNTYSMDSSWEIEKNQRYNNYSGLVHLVSPFKGYEK 1800
            .: |||..|            ...|:.....:||:.::|                  :|      
Zfish  1395 FSYVKVGGW------------SVLGKRGVKASYSISTAW------------------TP------ 1423

  Fly  1801 GGLVAHFSLSDQRVVSGAASLNFDLREFTLTMN-GYVKKFTDNMLTVNITTPLEKFGTINARFGL 1864
             .|....|:.:.:.|.            ||.|: ||.|:      .:||:..|   .|::.:.  
Zfish  1424 -ALHGQISVGNGKQVK------------TLEMSAGYGKQ------DLNISAVL---STLDKKL-- 1464

  Fly  1865 NEKKRHAVAEVRAPTAALGVEVLADIKNLLNFDVKLSVATPIESFQ-QAAIFALFNPERVDMRGL 1928
              |||..:..:          .|||:||            |....| :.||......:||     
Zfish  1465 --KKRLLMMTM----------TLADLKN------------PYAELQIEGAIEETRKDKRV----- 1500

  Fly  1929 WNNVTLGFTGVWHMQNITDFEYSYHVFTPLAGFEENGFIVQLLKRKEFVFQLHGKMSNYKLGVKI 1993
                   :...|.:.....|:     |.|.:          |:.::.|...||.|:...:..|.:
Zfish  1501 -------YQKRWKLNFRQPFK-----FLPQS----------LILQETFTSDLHHKVYTLESKVLV 1543

  Fly  1994 NGEPKSDLVNQLGSNKMELEMLYDADFKPLNAETDYKPDADEEYFSYFTNFQVDTLVWPTIVGNV 2058
            :|..|:..|..||             |:|   :..|...:..:.|| ......|:.:..|:..|.
Zfish  1544 HGNRKAIHVLTLG-------------FQP---QQPYMCSSLVQSFS-TERIPQDSKICFTVQNNQ 1591

  Fly  2059 DIQEIIDFYLVVGHVELPQGKVEFKDRLHYPDYINVHNLLTVTTPFAVAKNIKSIVEYHVDLNFN 2123
            ::.||        ||.|..|.   ::||.....:..|:..|......:..|:..:::....||.:
Zfish  1592 NVHEI--------HVRLWAGN---EERLEAFGQVQFHDPATFQQGITIKANLSQLIKMDFPLNVS 1645

  Fly  2124 AFYERVKFIVNDDKDNTQELGFVFNYTALQDNVKPKAHDVQVTLLTPYEMLHEIYVHGHIELDDN 2188
            ...|.:|                 ::.:..|                    .|.:..|.|.:|:.
Zfish  1646 LNIEALK-----------------SHRSKSD--------------------FEYHSEGQICIDNR 1673

  Fly  2189 AYKGNISAVTAH-THLSMAASIENEDNFLETSVGIQLETDAIPHYGCQVYFKKDFSAVDKAIDIR 2252
            .|:.|.:.:.:| .::|.:.|::.::.  .:::.:.||..|                        
Zfish  1674 IYQANTAMIVSHFGNISSSISLQADEK--NSTIHLILENKA------------------------ 1712

  Fly  2253 FEVTDNGTLNQLHISTDWHTDPSYIVNANGRIKTTMLPLQMASTSVLVIQGQNP--HLNFDLNLL 2315
                ..|: |.|.|..|:|.                          .::.|..|  |::...|..
Zfish  1713 ----GKGS-NALSIYADFHQ--------------------------TLLAGVTPEGHIHLYANCS 1746

  Fly  2316 SQNGQSIAYGARANKKKDVFNIEVWTPMKNFRNISMHGTAIRSPRDPGRYDVSGFLYRNMATYEV 2380
            |:.   :....|..|:.:.|              |.|                            
Zfish  1747 SER---VFLQCRVKKEDETF--------------SAH---------------------------- 1766

  Fly  2381 TGAVRMTNSLPIDVVLRVQPKAGGRDGVIELNIHEAGPKKIRFSFSAIEDGKMCQMSGGYSVSKT 2445
                 :|.|||.|                          |:..|.|.               ...
Zfish  1767 -----LTGSLPHD--------------------------KLHLSLSG---------------DVV 1785

  Fly  2446 NGAMDFSVLVESTEPEIARINFYGNLSPNSEGSLVGDLSLETPWKALGIDTVHLHSDVGFLNKGG 2510
            |...|.|.|..|       ::..|.|: .|.|...|:|::.......|::...            
Zfish  1786 NSIQDLSALPNS-------VSMVGVLT-QSNGLTEGELTVVVDDAVYGLEVTQ------------ 1830

  Fly  2511 HIVGEYKIGQYIGRGSCLWSWILAEDMQLVLENYLERPNAKPRIVHASAKYQNPGQTFTQLQAGG 2575
                  :.|:.:....|:  .|:.|.:.:.:.:.:.:        |....|.....:|..|....
Zfish  1831 ------QSGEDLRALLCV--VIMEESLCVNISSIVTQ--------HGCRSYTQLSHSFPWLHFAA 1879

  Fly  2576 RLSVDS------KWNLDVNGSAEYKSVDDFKFRVITALPLPVGDRHQLSASYQGNVISQQFNNPD 2634
            .|...|      .||   |.|            |...|.|. .|...|||:              
Zfish  1880 GLPFHSSAGVFMNWN---NSS------------VCAQLELH-ADARGLSAT-------------- 1914

  Fly  2635 FVLEASYESFEAQNKLLSRISYKNATNNLKGLGHVEWGKIQNLSVVEGDFELLHKQGAQREFSAK 2699
              ||.|.:         |:::|....|.         |.:..:...:...:.| |.|.:....:.
Zfish  1915 --LEQSSQ---------SQVNYTEGINT---------GPLLAICSEQDQKDTL-KVGVRANLQSS 1958

  Fly  2700 IITPKFKNEHTFALTGSYDLEKSGHHNVVGSLDYPASRRITDLDVSVSSLSNMHGIFNSTLPTFL 2764
                          |.|:||:  ||||:                              |:....|
Zfish  1959 --------------TFSFDLQ--GHHNI------------------------------SSTGLML 1977

  Fly  2765 NVS--------WLKTDFNFTTNNGKSYRYCRC------------FWPQDTAYFKLNSNYDSDSSN 2809
            |:|        :|.:||...:...:|....:|            |   |......||.: ..:..
Zfish  1978 NISHNTPALHPYLPSDFYSKSQLRRSQSSAKCTAELLVGVSSLAF---DAEILSANSGF-KQALV 2038

  Fly  2810 FNHNLNGNVEIEVPLATRHRADIVYGLQKRRNQDAGNVKVVYNEKQVLDGKYKRLEQAKAPIYKE 2874
            |||::.     ::.|..|:.                .|:.:|..|:                   
Zfish  2039 FNHSIP-----QLHLLPRNL----------------TVRTLYGGKR------------------- 2063

  Fly  2875 TTDISLENEVKPLGIHFVSTRDASDPAGSQDVKHIEIYELRNTQNFNLTGELHSRATLKAQDFKV 2939
                         |.|..:.|...|   :||..|                      |..:.|:  
Zfish  2064 -------------GSHIFTHRAQWD---NQDSTH----------------------TTSSYDY-- 2088

  Fly  2940 VAIHPNRAVVLSTKYEDVSPEVVRHHSKLELSETAWIGYNLELGNFSKVGNESQ------SFALE 2998
                        |:::...|         ||:.|| :|:.|:|    ||.|:||      :....
Zfish  2089 ------------TQFQQSYP---------ELTGTA-LGWGLDL----KVENDSQRKLGDLNMDWS 2127

  Fly  2999 IFYPKRNLSSSGQYYMTDTNFNSDLSFQWLGGNYDQQPKIIHSNLQWKAEPLHRGDREHRTIALT 3063
            :|..:..|...|.:.:.....:|.          :|:...:.:..|:....|..| ..:|...::
Zfish  2128 LFGSREELKVQGSWALVSRQMDSS----------EQKQAFVSTLTQFHIHALSHG-LTNRNEGIS 2181

  Fly  3064 VAH--PLLEKDINCKATYYRGLRDLLRTHLTIDYSE-------YPDQ------LIELG-----AQ 3108
            .||  ....|.:|...|        :..|...|.|.       .|.|      |:|:.     ||
Zfish  2182 QAHISTSHRKPVNVSVT--------VSEHWHGDSSRGQACVFILPGQMQTLLPLVEMEGCVAVAQ 2238

  Fly  3109 LTDRYSELGHTNYTFHVYGKHIASELDVQ-----LNGTLAAMNSYYKTESTAHYKRDIFPARYGK 3168
            ....||:    |.......|.|...:..|     ::..|..:.:...:.|         |.....
Zfish  2239 DGKSYSQ----NTELKWKDKRITQSMKYQCGVKGMHTLLVELGAQNVSPS---------PCPSHS 2290

  Fly  3169 FLALLDVNKRE-LEYERQSPFHAVRLHLLPTIRYPIYGLNATIWDTPDTNHSGYIYMDILERYAR 3232
            .|..:..|.|: ||       |.|::.|.|.  .|     |.||......:||   .::|..::|
Zfish  2291 LLTQIHTNLRDHLE-------HHVQIGLCPP--QP-----ALIWSGSHRVNSG---KEMLLTHSR 2338

  Fly  3233 MD---------FNLTEDASQNLQMVGYIPDTRSAFLDIWR--NYEEIRVIDVSSYLKMNHSRLIT 3286
            :.         |.|:...:.:.|...|      :.|..|:  |:.    ::::|      |.:::
Zfish  2339 VSVSGHPQHSTFTLSLRNTSSSQRSNY------SLLTEWQVGNWS----VELAS------SSMVS 2387

  Fly  3287 GRFHWRPSIRQEVREKIQ---------AVGKSVYSSFSEGIDFWIKSIYTETTESMGVVWNTAKE 3342
            ||     |:..:|..|:.         |:||....:.:        ..:|||::           
Zfish  2388 GR-----SVAVQVHAKLDRSELLWLQGALGKRCLRAAA--------GYHTETSD----------- 2428

  Fly  3343 YNRDFIDDIGQLSVLEEDLADLRLFVNQSYEANDFYI-------KNVVNFTLTILDELAIRDHIE 3400
                                ||||.:  ..|.:.::.       ..:.|.||.::...|....: 
Zfish  2429 --------------------DLRLLL--CSEGHHWFTLEAQRGGAGIENETLALISVGAANQSL- 2470

  Fly  3401 SLPKIFSE------LWQA---MGDSGKALRNSIVWLIETIKTTYNNLLDAVARFFH--------- 3447
                :|..      ||.|   :...|..:|              |.|.|...|..|         
Zfish  2471 ----LFGAKGCGDCLWAAEARLQQLGSRIR--------------NKLFDRFQRLQHLLLTFRRQA 2517

  Fly  3448 GES--LVYISG-----------LLEKGIAKYDSFIKDLHIKFIKYIENLWHKTWTLAENHWKAVL 3499
            |:|  |:.:|.           |||:...                   || |.||...  .:..|
Zfish  2518 GDSVFLLELSAWPLSLTQRAETLLERSAV-------------------LW-KAWTTGP--LRHTL 2560

  Fly  3500 KRFEPHLFKMISFIETTAWNLSKEVFDFIYKRTNELAESPYFNKVSSFTADAERLYRDFKANDAI 3564
            ....|:..:::..       :|::|...:.|....||.:                |.|      :
Zfish  2561 THSLPNALQLLHL-------MSQQVQQELRKPLATLAGA----------------YHD------V 2596

  Fly  3565 TNIKKYSTIAWNFVKEKYFKLVPFGAELNEVLTEIWQEIKELEKIDQVQIMVQKYYEVMAKVDWV 3629
            |                           .|.|..:||:        .||:..::..|::..:   
Zfish  2597 T---------------------------GERLDAVWQQ--------GVQMWTRELTELLPSM--- 2623

  Fly  3630 ADELQLEHRLHQVYGLVRNKFRNYAMNALETA----DM-------YREAKTK------------- 3670
                     ||..:      .|..::.||..|    ||       :.||:..             
Zfish  2624 ---------LHDPH------LRTPSLTALHAAVFAMDMVSQQTFQWMEARLAAMLVGVRRQLALI 2673

  Fly  3671 FVFDPEVGIIDLEQKLPMS-WHAFNETPRFEEIPEYQVLAKAQSFFSETNSSIVMKLYNMRTHLD 3734
            :.|....|.:.|...||.. |....:....|.:.|..||   :...:..:.|...:||.::..:.
Zfish  2674 YKFSKSEGELMLRVPLPEGPWLMVKDAGMTEVLLEEFVL---KPLLALNSMSPTAELYRLKRRIM 2735

  Fly  3735 PKTWLPPYYSRALLIDSRHYMTFDQRYVGLNLNFDELGNGRSTSQCSYLLAHDFFKRNFTLLLEP 3799
            ..   |..| :|.|:...:.::||.....|            .:.|.::||.|..|..|::.|:.
Zfish  2736 DS---PANY-QAFLVADVYLVSFDGHLFQL------------PAACDFILAADVTKNTFSIALKS 2784

  Fly  3800 A---SKSLAGQGLTRKLSFIANGQLIEIDLETDHISINGNPQPILPLKLGDVNIHRDLDVLSITS 3861
            .   .:||..|......:..|||: :|::....|:... ||         :|.:.:|::.:.:::
Zfish  2785 GRFKRRSLVMQMQNTTTAIHANGE-VEVNCHVTHVPYT-NP---------EVAVRKDVNFIEVSN 2838

  Fly  3862 DTEFSLHCNVQFDLCWFEVSGWYFGRTAGLLGTLNNEPYDEYTMSSGVISNETQLFTDSWSL-KQ 3925
            .....:.|:...::|...:.||..|.::|||||.:||..:|..:..|..::....|..||.: .:
Zfish  2839 GRGLWVSCDHHLEVCSVILDGWLHGVSSGLLGTNDNEGSNEQLLPDGSHTSGLLQFAHSWQVDSE 2903

  Fly  3926 CRQNKLAQTQEVSQEVSDACTSFFRT--GILATCSAVLDPTPFYEMCMDLG-MKSPPIRKGHPAV 3987
            |...|....|..:.: |.:||..|.:  ..|:.|..|:||..|...|..|. ::........||.
Zfish  2904 CVSRKADVCQNATAD-SLSCTFLFSSTNSPLSPCFRVVDPVQFAMECEILECVRDERADVPKPAY 2967

  Fly  3988 KGACAAALAYIEACTALKVPMRVPSQCV 4015
               |:.|.|||..|....||:.:|.|||
Zfish  2968 ---CSLASAYIHVCHRNYVPLELPVQCV 2992

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ApoltpNP_995670.2 LPD_N 49..633 CDD:214755 152/618 (25%)
DUF1943 665..1012 CDD:286281 74/374 (20%)
DUF1081 1029..1122 CDD:283982 27/100 (27%)
VWD 3741..3908 CDD:295339 38/170 (22%)
C8 3951..4014 CDD:285899 20/66 (30%)
si:dkeyp-106c3.1XP_021322449.1 Vitellogenin_N 43..575 CDD:331790 151/625 (24%)
DUF1943 608..892 CDD:312626 72/357 (20%)
VWD 2748..2885 CDD:321964 35/160 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG4338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0008740
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.