DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Apoltp and Apob

Sequence 1:NP_995670.2 Gene:Apoltp FlyBaseID:FBgn0032136 Length:4333 Species:Drosophila melanogaster
Sequence 2:NP_062160.2 Gene:Apob RGDID:2129 Length:4506 Species:Rattus norvegicus

Alignment Length:4787 Identity:900/4788 (19%)
Similarity:1622/4788 (34%) Gaps:1460/4788 (30%)


  Fly     1 MGGLKP--QAAIWL--LLLIAHTQAVRENPLKDPRICGRPQCDSKSAKFNYGEQLYKYQYTVAVR 61
            ||..:|  :|.:.|  |||...|....::.:.:..|.   .|...:.:|.:..: |.|.|.....
  Rat     1 MGPQRPALRAPLLLLFLLLFLDTSVWAQDEVLENFIL---NCPKDATRFKHLRK-YVYSYEAESS 61

  Fly    62 TEFAGSGDNSSDLLLKSDLEIFFPKPCEGYLRINDAKLYDTLDEL---NDNESDSSEKTKEYDYY 123
            :...|:.|:.|...:...:|:..|:.|...:|.:..    ||.|:   |.......:|||     
  Rat    62 SGVRGTADSRSATKINCKVELEVPQVCTLIMRTSQC----TLKEVYGFNPEGKALMKKTK----- 117

  Fly   124 DNLANEESESQNYDNMHPKSSDFNVDLTKNLLRFAFHDGLISEVCPQEQETPWVLNIKKGILSA- 187
                              .|.:|...:::..|:.||.:|....:.|...|..::||||:||:|| 
  Rat   118 ------------------NSEEFASAMSRYELKLAFPEGKRVALYPDLGEPNYILNIKRGIISAL 164

  Fly   188 -------------FQNTMMRFDVDANTTETDVSGQCQVQYALEDTDSSYVTIRKT-KDINSCR-- 236
                         ||:|              |.|.|..|..:.....:..|...| :::..|.  
  Rat   165 LVPPETEEDKQVLFQDT--------------VYGNCSTQVTVNSRKGTVATEMSTERNLQHCDGF 215

  Fly   237 QRYATH-SVLQTTPYTFRDDKTIWPILKSQSHCNLTID--NNVYKEIKCLETHLLVPFSNASS-G 297
            |..:|. |.|.......|...|:  |..||| |..|::  .....|..|.|.||.:|||..:. |
  Rat   216 QPISTSVSPLALIKGLVRPLSTL--ISSSQS-CQYTLEPKRKHVSEAICNEQHLFLPFSYKNKYG 277

  Fly   298 ALTTSTSRLKLDGVESYSAGEFLEQNPELVER-------RATLVFDHTPAVKPSHDEIKAARELL 355
            .:|..|.:|.            ||..|::..|       :..|.|:.|.:..|. .:..|..:.|
  Rat   278 IMTHVTQKLS------------LEDTPKINSRFFRGGINQVGLAFESTKSTSPP-KQADAVLKTL 329

  Fly   356 VEMCRVGFPNIQREFIDVFTNFLQTSKSLDYKTLSVLLQRSASTCEQGRNHLLESLPFIGSTASY 420
            .|:.::.......:..::|...:...:.|..:.::.||.:   ..|......|::|...|....|
  Rat   330 QELKKLSISEQNAQRANLFHKLVTELRGLSGEAITSLLPQ---LIEVSSPITLQALIQCGQPECY 391

  Fly   421 KVMRDQIINEKLTKQMAH----DWMTAL-SFITRPDEETLETFHSILEYAKNRLDAEYTLGATA- 479
            ..:...:..||     ||    |.:|.| :.|..|..:.|:   .|...|| .|.:..||.|.: 
  Rat   392 THILQWLKTEK-----AHPLLIDIVTYLMALIPNPSVQRLQ---EIFNTAK-ELQSRATLYALSH 447

  Fly   480 VVHSFCKHHEACEENLRVQQIINLLETEFLNLYNLFKGERRTRERMVILLKGLGNIG----VVSS 540
            .|:|:    .|..::.|...:.::.......:.|...|:   .:|..::|:.:||:|    .|..
  Rat   448 AVNSY----YAIMDHSRSPVLEDIAGYLMKQIDNECMGD---EDRTFLILRVIGNMGRTMERVMP 505

  Fly   541 AFAEQLQWIIREDEAPVDIRLHGILAFRRVDCARH-RSYFLDNYGNYTLNSELRIYSYLQAMRCP 604
            |....:...:|..:..:.|:...:.|.|:::.... |:...|.:.|.....|.|:.:||..||.|
  Rat   506 ALKSSVLNCVRSTKPSLQIQKAALQALRKMEMGDEVRTILFDTFVNDVAPVEKRLAAYLLLMRSP 570

  Fly   605 DYISVGVIKSILEHEEINQVGSFVWSHLTNLAKSNSPVRIEAQGLLLNDELSERFK--MDIRKFS 667
            ....:..|..:|:.|:..||.:||.||:.|:..|......:.:.|:.|..::.|..  ||.||||
  Rat   571 SSSDINKIAKLLQWEQSEQVKNFVASHIANILNSEELYVQDLKNLIKNALVNSRLPTIMDFRKFS 635

  Fly   668 RNYEHSL-----FFDEYNFGTTTDANVIFGTDSYLPRIASVNFTADLFG-QSVNFFEFTARAEGL 726
            |||:.|.     .||..:  ...:.|::|...||||:.:.:..|..:|| .|::.||.....:|.
  Rat   636 RNYQISKSVSIPLFDPVS--AKIEGNLVFDPSSYLPKESMLKTTLTVFGIASLDLFEIGLEGKGF 698

  Fly   727 EELAANAFGPKG--PLSGQLLRKKLSFLNRWLGNESAEEDDTLENLLSLDNLRLKRKAQEQARAS 789
            |......||.:|  |.|   :.|.|.::|                            .|...|.|
  Rat   699 EPTLEALFGKQGFFPDS---VNKALYWVN----------------------------GQVPDRVS 732

  Fly   790 EEEVDEDYDFEESLEGNKRQKRDVSTTRKQEIDRNVDSLGYKLKYDYNNPRAQFGLRVFGNDLRY 854
            :..||. :.:.:    :.:.::|:.......:|:.:..|..|     ..|.|:..||:.|.:|.:
  Rat   733 KVLVDH-FGYTK----DDKHEQDMVNGIMPIVDKLIKELKSK-----EIPEARAYLRILGKELGF 787

  Fly   855 FNVESLVEVMAL----AAKFN--PFQQAKNVLSGKEFTYTKSRVFLDASYTVPLAVGLPLAIHAF 913
            ..::.|..:..|    |..|.  |....:.:..|.:.......:|::.::.:|..|||.|.:.:.
  Rat   788 VRLQDLQVLGKLLLNGAQTFRGVPQMIVQAIREGSKDDLFLHYIFMENAFELPTGVGLQLQVSSS 852

  Fly   914 GASSIDLRVSGNLDEMDPPTDWHFDVEGQFKPSVSVDVITTMQTDM-FWEQSGIKVKSNLYSNSE 977
            |..:..::....|:..      :...|...|||||::.:|.|...: .:.:||:::.:|.:..|.
  Rat   853 GVFTPGIKAGVRLELA------NIQAELVAKPSVSLEFVTNMGIIIPDFAKSGVQMNTNFFHESG 911

  Fly   978 LVAKLKVRGRNLVSFSFDLPRDKNEIFSVRSEL-LVQKREEQLPQAGIANRSANSTCTWPVLDQA 1041
            |.|::.::...| ......|:...::||..:.| ||...:.::....|.||.:.|||. |..   
  Rat   912 LEARVALKAGQL-KVIIPSPKRPVKLFSGSNTLHLVSTTKTEVIPPLIENRKSWSTCK-PFF--- 971

  Fly  1042 IGLQMCS--HYSVPDLSNATEIYPSLLLAGPLNFSLILKKSDLSAKKYVFEYKWDQQEEDNNFSL 1104
            .|:..|:  .||....:.:...||   |.|...:.|.||.:. ..::|.....::..:||.  ||
  Rat   972 TGMNYCTTGAYSNASSTESASYYP---LTGDTRYELELKPTG-EVEQYSASATYELLKEDK--SL 1030

  Fly  1105 VFTTPGSKVPRVLVANVTKVPDAFNASVAFVNGPNRVSAGCSYDGNPDFRRLDIYLDTNGNRSLD 1169
            |.|.      :.||.               ..|..:..|...:..|...|.|...:...| ..::
  Rat  1031 VDTL------KFLVQ---------------AEGVQQSEATAMFKYNRRSRTLSSEVLIPG-FDVN 1073

  Fly  1170 LGMELRRHQDFTAWIYNPRMLLAINGVNIT--GLAGTVKVNEKNGIKQHDVDLSFETKKLQAVIK 1232
            .|..||.:.:.:......:::|.|....||  .:.|.|..::|...|...|   ....:|||..:
  Rat  1074 FGTILRVNDESSKDKNTYKLILDIQNKKITEVSVVGHVSYDKKGDGKVKGV---VSIPRLQAEAR 1135

  Fly  1233 GNV------------VQSEIT---TSTNMTIKYRFQANKIEEINFAGKLVNNGDKSKTEYRGNMK 1282
            ..|            :.|..|   ::.:..:.:|:...|||   |......|.|..|.  ..|..
  Rat  1136 SEVHTHWSPTKLLFQMDSSATAYGSTISKRVAWRYDNEKIE---FDWNTGTNVDTKKV--ASNFP 1195

  Fly  1283 LQTSAYPKLNFASESTWLSLQGHTEGMITYNNAPDYVNPNYTSLVRLIFARSHSEDSFLDGTQT- 1346
            :..|.||::          :..:..|::      |:..|......|      |.....:..|.| 
  Rat  1196 VDLSRYPRM----------VHEYANGLL------DHRVPQTDMTFR------HMGSKLIVATNTW 1238

  Fly  1347 --RASLELKLPRSKIDYRILVKHKEHIKNGTEHNVIVGLKYTPEKEITGLFSVHLPRRNLFAIDA 1409
              .|:..|..|:|.         ::|:...:|.|:       |:   .||...|:|.......|.
  Rat  1239 LQMATRGLPYPQSL---------QDHLNGLSELNL-------PK---VGLPDFHIPDNLFLKTDG 1284

  Fly  1410 YMNVTVPEFN-SCTASLKVNEKATKDYIIFINGSWFTGHSVAVKA-NYKDRSSRVQALHHLKMIV 1472
            .:..|:.:.. .....|.:..|::||..:        ..||...| |:|.     ...|.....|
  Rat  1285 RVKYTLNKNRIEIDIPLPLGGKSSKDLKV--------PESVRTPALNFKS-----VGFHLPSQEV 1336

  Fly  1473 ESPSFNITSLNIIYRRKQLLIFYDIQAKYDQDPYGLTIQYASNAHNRNTNAEVRLKVKERDYWIN 1537
            :.|:|.|...:.:  :..||...|:......:.|..::.|...    ||:         ||::  
  Rat  1337 QIPTFTIPKTHQL--QVPLLGILDLSTNVYSNLYNWSVSYTGG----NTS---------RDHF-- 1384

  Fly  1538 AKLLSEQPKLLQLEIHM--DKIRDVHIQVGLLNVDKRKELSLELKWDANRDPSQRLGLLAEYNSP 1600
                     .||.:..|  |.:.|:.            ..|::...:...|......|..:    
  Rat  1385 ---------SLQAQYRMKADSVVDLF------------SYSVQGSGETTYDSKSTFTLSCD---- 1424

  Fly  1601 GTKHY---DGNLMITYPERTIHFGFNSFTGGPKYFGKVHASWSINEVIEFEYEAGILPGHTL--- 1659
            |:.|:   |....:::.|:   ||.|..:.|               ::.||..:.:.|..:.   
  Rat  1425 GSLHHKFLDSKFKVSHVEK---FGNNPVSKG---------------LLTFETSSALGPQMSATVQ 1471

  Fly  1660 -------HNWVKAELRTPFDG-WRVNSLDA-GIYSL-------------KNLILVNSTLFWADDQ 1702
                   |.:|| :::.  || :||.||.| |.|.|             ::.:..|||.|...:|
  Rat  1472 LDSKKKQHLYVK-DIKV--DGQFRVFSLYAQGEYGLSYERDSMTGQMSGESNMKFNSTYFQGTNQ 1533

  Fly  1703 KLQVGYKSDYDVNDQLMSFDVRFGINSTIRDIPTINVKVKHW-MDVKKVDTELYLGYSGQNDTFN 1766
              .||...|..::....| |::.||...     |.::|.::: :.:|...:..|..::..|....
  Rat  1534 --IVGMYQDGMLSVTSTS-DLQDGIFKN-----TASLKYENYELTLKSDSSGQYENFAASNKLDM 1590

  Fly  1767 TYSMDSSWEIEKNQRYNNYSGLVHLVSPFKGYEKGGLVAHFSLSDQRV-----VSGAASLNFDLR 1826
            |:|..|:  :.:::...||..| .||:...|          ||:.|.|     :.|...:|....
  Rat  1591 TFSKQSA--LLRSEHQANYKSL-RLVTLLSG----------SLTSQGVELNADILGTDKINTGAH 1642

  Fly  1827 EFTLTMNGYVKKFTDNMLTVNITT-----PLEKFGTINARFGLNE-----------KKRH----- 1870
            :.||       |...:.::.:.||     ||.....:||..||:.           |:.|     
  Rat  1643 KSTL-------KIAQDGVSTSATTNLKYSPLLLENELNAELGLSGASMKLSTSGRFKEHHAKFSL 1700

  Fly  1871 ----AVAEVRAPTAALGVEVLADIKNLLNF-----DVKLSVATPIESFQQAAIFALFNPERVDMR 1926
                |:.||...:....:.:.||.||:.||     .:|||                     .||.
  Rat  1701 DGRAALTEVSLGSIYQAMILGADSKNVFNFKLSREGLKLS---------------------NDMM 1744

  Fly  1927 GLWNNVTLGFTGVWHMQNITDFEYSYHVFTPLAGFEENGFIVQLLKRKEFVFQLHGKMSNYKLGV 1991
            |.:..:.|..|   |...|:.....:  |:.:    :|.:......::.|..||    ..|..|:
  Rat  1745 GSYAEMKLDHT---HSLRISGLSLDF--FSKM----DNIYSGDKFYKQNFNLQL----QPYSFGI 1796

  Fly  1992 KINGEPKSDLVNQLGSNKMELEMLYDADFKPLNAETDYKPDADEEYFSYF----------TNFQV 2046
            .::.:.|.|.:....:.::.||.|      .||...::|.........:.          .:::.
  Rat  1797 TLSNDLKYDALVLTNNGRLRLEPL------KLNVGGNFKGTYQNNELKHIYTISYTDLVVASYRA 1855

  Fly  2047 DTLVWPTIVGNVDIQEIIDFYLVVGHVELPQGKVEFKDRLHYPDYINVHNLLTVTTPFAVAKNIK 2111
            ||:.  |:.|                       |||..||: .|...:.:.:.|||         
  Rat  1856 DTVA--TVQG-----------------------VEFSHRLN-ADIEGLASSVDVTT--------- 1885

  Fly  2112 SIVEYHVD-LNFNAFYERVKFIV------------NDDK-----DNTQELGFVFNYTALQDNVKP 2158
               .|..| |:||..:   :|::            .|.|     ::|.::     |:......:|
  Rat  1886 ---SYSSDPLHFNNVF---RFVLAPFTLGVDTHTSGDGKMSLWGEHTGQM-----YSKFLLKAEP 1939

  Fly  2159 KA----HDVQVTLLTPYEMLHEIYVHGHIELDDNAYKGNISAVTAHTHLSMAASIENEDNF-LET 2218
            .|    ||.:.:  |.:.:|               ||.::|....||..::....|...:: .:|
  Rat  1940 LALTFSHDYKGS--TSHNLL---------------YKNSVSTALEHTLSALLTPAEQTSSWKFKT 1987

  Fly  2219 SVGIQLETDAIPHY------GCQVYFKKDFSAVDKAIDIRFEVTDN-GTLNQLHISTDWHTDPSY 2276
            |:..::.:.....|      |.::..:.|.|.:...|.:.|..::. ..||.|.|:..:.....:
  Rat  1988 SLNDKVYSQEFEAYNTKDKIGIELSGRADLSGLYSPIKVPFFYSEPVNVLNSLEINDAFDEPREF 2052

  Fly  2277 IVNA------NGRIKTTMLPLQMASTSVLVIQGQNPHLNFDLNLLSQNGQSIAYGARANKKKDVF 2335
            .::|      |..:.|..||...:..                :.|.:|.:.|             
  Rat  2053 TIDAVVKYDKNQDVHTISLPFFQSLP----------------DYLERNRRGI------------- 2088

  Fly  2336 NIEVWTPMKNFRNISMHGTAIRSPRDPGRYDVSGFLYRNMATYEVTGAVRMTNSLPIDVVLRVQP 2400
             |.:...||                        |.|.|                |.:|..:|...
  Rat  2089 -ISLLEAMK------------------------GELQR----------------LSVDQFVRKYR 2112

  Fly  2401 KAGGRDGVIELNIHE-----------AGPKKIRFSFSAIEDGKMCQMSGGYSVSKTNGAMDFSVL 2454
            .|..|   :...||:           ||.|:           |:......|.::      |..||
  Rat  2113 VALSR---LPQQIHDYLNASDWERQVAGAKE-----------KLTSFMENYRIT------DNDVL 2157

  Fly  2455 VESTEPEIARINFYGNLSPNSEGSLVGDLSLETPWKALGIDT-VHLHSDVGFLNKGGHIVGEYKI 2518
            :..   :.|:||....||           .|||  .|:..|. :..:.|...|.:        .|
  Rat  2158 IAL---DSAKINLNEKLS-----------QLET--YAIQFDQYIRDNYDAQDLKR--------TI 2198

  Fly  2519 GQYIGRGSCLWSWILAEDMQLVLENYLERPNAKPRIVHASAKYQNPGQTFTQLQAGGR---LSVD 2580
            .|.|.|        :.|.::::.|.|..|.|....|.:.....:|  ....|:.:.|.   .:||
  Rat  2199 AQIIDR--------IIEKLKMLDEQYHIRVNLAKSIHNLYLFVEN--VDLNQISSSGASWIQNVD 2253

  Fly  2581 SKW------------------NLDVNG-SAEYKS------------------------------- 2595
            :|:                  |:|:.. :||.|.                               
  Rat  2254 TKYQIRIQIQEKLQHLRTQIHNIDIQQLAAELKQQIEALDVPMHLDQLRTAILFQRISVIIERVK 2318

  Fly  2596 ------VDDFK-------FRVITALPLPVGDRHQLSASYQGNVISQQFNNPDFVLEASYESFEAQ 2647
                  ::|||       ||||.         .:|...|:.:...|...:....|...|...|..
  Rat  2319 YFVMNLIEDFKVTEKINTFRVIV---------RELIEKYEVDRQIQVLMDKSIELAHRYSLSEPL 2374

  Fly  2648 NKL---LSRISYKNATNNLKGL--GHVEWGK-IQNLSVVEG---------------DF-ELLHKQ 2690
            .||   |.:|..|:..:.|.|.  ..|||.| :...:::|.               |: :.:.|.
  Rat  2375 QKLSNVLQQIEIKDYYDKLVGFIDDTVEWIKAVSFKNIIEELNRLIDMSVKKLKAFDYHQFVDKT 2439

  Fly  2691 GAQ-REFSAKIIT-------PKFKNE------HTFALTGSYDLEKSGHHNVVGSLDY-------- 2733
            .:: ||.:.:|..       |: |.|      ..|..|.|..|||.....|...:|:        
  Rat  2440 NSKIREMTQRINAEIQALELPQ-KTEALKLWVEDFKTTVSNSLEKLKDTKVTVVVDWLQDGLAQI 2503

  Fly  2734 ---------PASRRITDLDVS------VSSLSNMHGIFNSTLPTFLNVSWLKTDFNFTTNNGKSY 2783
                     ....||..:|:.      :|.:|.::    ||:.|:::..|..|..|.|   ..:.
  Rat  2504 KAQFQDALEDVRDRIYQMDIQGELERCLSLVSQVY----STVVTYISDWWTLTAKNIT---DFAE 2561

  Fly  2784 RYCRCFWPQDT-AYFKLNSNYDSDSSNFNHNLNGNV--EIEVPLATRHRADI-VYGLQKRRNQDA 2844
            :|....|.:.. |..:                .|.:  ||:..|.|....:: ::.||:...|..
  Rat  2562 QYSTQKWAESVKALVE----------------QGFIVPEIQTFLGTMPAFEVSLHALQEANFQTP 2610

  Fly  2845 GNVKVVYNEKQV--LDGKYKRLEQAKAPIYKETTDISLEN------------EVKPLGIHFVSTR 2895
            ..: |...:.::  :...:|.|:..|.|:...|.:.:|.|            |:|...|..:...
  Rat  2611 DFI-VPLTDLRIPSIWINFKMLKNVKIPLRFSTPEFTLLNTFRVRSFTIDLLEIKAKIIRTIDQM 2674

  Fly  2896 DASD-----PAGSQDVKHIEIYELRNTQNFNLTGELHSRATLKAQDFKVVAIHPNRAVVLSTKYE 2955
            .:|:     |         |:| ||:.:..|:     |.|.|...||.|..|......:.:...:
  Rat  2675 LSSELQWPLP---------EVY-LRDLEMVNI-----SLARLSLPDFHVPEITIPEFTIPNVNLK 2724

  Fly  2956 DVS-PEVVRHHSKLELSETAWIGYNLELGNFSKVGN----ESQSFALEIFYPKRNLSSSGQ--YY 3013
            |:. |::  |..:.:|..   :....|:..|.|:.:    :|..|.|:.....:|:::|..  ..
  Rat  2725 DLQVPDL--HIPEFQLPH---LSCTTEIPAFGKLHSVLKIQSPLFILDASANIQNITTSENKAEI 2784

  Fly  3014 MTDTNFNSDLSFQWLGGNYDQQPKIIHSNLQWKAEPLHRGDREHRTIALTVAHPLLEKDINCKAT 3078
            :.......:..|:.|..::..|.:.:..|    |.||                 :|::.:|..:.
  Rat  2785 VASVTARGESKFEALNFDFQAQAQFLELN----ANPL-----------------VLKESVNFSSK 2828

  Fly  3079 YYRGLRDLLRTHLTIDYSEYPDQLIELGAQL---TDRYSELGHTNYTFHVYGKHIASELDVQLNG 3140
            :.|              .|:..:::..|..|   :|..:.| ||......:.           ||
  Rat  2829 HVR--------------MEHEGKILVSGKALEGKSDTVARL-HTEKNTVEFN-----------NG 2867

  Fly  3141 TLAAMNSYYKTESTAHYKRDIFPARYGKFLALLDV-NKRELEYERQSPFHAVRLHLLPTIRYPIY 3204
            .:..:|:.:..:|...|...:...|       ||. :|..|..|.::...|..:      .:...
  Rat  2868 IVVKINNQFTLDSQTKYFHKLSVPR-------LDFSSKASLNNEIKTLLEAGHM------AWTSS 2919

  Fly  3205 GLNATIWDTPDTNHSGYIYMDILERYARMDFNLTEDASQNLQMVGYIPDTRSAFLDIWRNY--EE 3267
            |..:..|..|:.:..|.                      :...:.:|.|...|...:..|.  :.
  Rat  2920 GTGSWNWACPNFSDEGI----------------------HSSKISFIVDGPIASFGLSNNINGKH 2962

  Fly  3268 IRVI----DVSSYLKMNHSRLITGRFHWRPSIRQEVREKI--QAVGKSVYSSFSEGIDFWIKSIY 3326
            :||:    ..|.:|  |:||.             ||..|:  |.||.|:.:  :||     :::.
  Rat  2963 LRVVQKLTSESGFL--NYSRF-------------EVESKVESQHVGSSILT--AEG-----RALL 3005

  Fly  3327 TETTESMGVVWNTAKEYNRDFIDDIGQLSVLEEDLADLRLFVNQSYEA-----NDFYIKNVVNFT 3386
            .:....|      ..|:|.:....:  :..|:..|    .|..|.:|.     |:..:|  |:|.
  Rat  3006 GDAKAEM------TGEHNANLNGKV--IGTLKNSL----FFSAQPFEITASTNNEGNLK--VSFP 3056

  Fly  3387 LTILDELAIRDHIESLPKIFSELWQAMGDSGKALRNSIVWLIET--IKTTYNNLLDAVARFFHGE 3449
            |.:..::   |.:.:.....|...|...           |.:.|  .:..||....|:....:.|
  Rat  3057 LKLTGKI---DFLNNYALFLSPHAQQAS-----------WQLSTRFNQYKYNQNFSAINNEHNME 3107

  Fly  3450 SLVYISGLLEKGIAKYDSFIKDLHIKFIKYIE------NLWHKTWTLAENHWKAVLKRFEPHLFK 3508
            :.:.::|............|.::::.:.::..      ::|.:|.          ||        
  Rat  3108 ASIVMNGDANLDFLNIPLTIPEINLPYTRFTTPLLKDFSIWEETG----------LK-------- 3154

  Fly  3509 MISFIETTAWNLSKEVFDFIYKRTNELAESPYFNKVSSFTADAERLYRDFKANDAITNIKKYSTI 3573
              .|::||     |:.||...|                         ..:|.|            
  Rat  3155 --EFLKTT-----KQSFDLSIK-------------------------AQYKKN------------ 3175

  Fly  3574 AWNFVKEKYFKLVPFGAELNEVLTEIWQEIKELEKI--DQVQIMVQKYYEVMAKVDWVADELQLE 3636
                 ::|:..::|.......:|..:....::.||:  :.:..:...|.|...|.    |:.:.|
  Rat  3176 -----RDKHSVVIPLKMFYEFMLNNVNSWDRKFEKVRDNALHFLTASYNETKIKF----DKYKTE 3231

  Fly  3637 HRLHQVYGLVRNKFRN----------YAMNALETADMYREA-KTKFVFDPEVGIIDLEQKLPMSW 3690
            :.|:|.....:|:...          :|:..|.::.:..:| :|..|..|...||          
  Rat  3232 NSLNQPSRTFQNRGHTIPVLNIEVSPFAVETLASSHVIPKAIRTPSVTIPGPNII---------- 3286

  Fly  3691 HAFNETPRFEEIPEYQVLAKAQSFFSETNSSIVMKLYNMRTHLDPKTWLP---PYYSRALLIDS- 3751
                       :|.|:::.          .|:.:.::::     |:|...   |.:.:...||: 
  Rat  3287 -----------VPSYRLVL----------PSLQLPVFHI-----PRTLFKFSLPDFKKLSTIDNI 3325

  Fly  3752 --------RHYMTFDQRYVGLNLNFDELGN-----GRSTSQCSYLLAHDFFKRNFT--LLLEPAS 3801
                    .:..:|....:.||.|.. |.|     .|..|..|::.....:|...|  |:.:...
  Rat  3326 YIPAMGNFTYDFSFKSSVITLNTNAG-LYNQSDLVARFLSSSSFVTDALQYKLEGTSRLMRKKVL 3389

  Fly  3802 KSLAGQGLTRKLSFIANGQLIEIDLETDHISI-------------------NGNPQPILPLKLGD 3847
            |......||.|....::...|.:..:....|:                   |||.:. .|.....
  Rat  3390 KLATAVSLTNKFLKGSHDSTISLTKKNMEASVKTTANLHAPIFTMNFKQELNGNTKS-KPTVSSS 3453

  Fly  3848 VNIHRDLDVLSITS------DTEFSLHCNVQFDLCWFEVSGWYFGRTAGLLGTLNNEPYDEYTMS 3906
            :.::.|.:...:.|      |.:|||.....:    ..:..:..|   .:.|:..::.|      
  Rat  3454 IELNYDFNSSKLHSAAKGGVDHKFSLESLTSY----LSIESFTKG---NIKGSFLSQEY------ 3505

  Fly  3907 SGVISNETQLFTDSWSLKQCRQNKLAQ---------TQEVSQEVSDACT---------------- 3946
            ||.::||..::.:|   |..|.:...|         ..||.:..:...|                
  Rat  3506 SGSVANEANVYLNS---KGTRSSVRLQGASNFAGIWNFEVGENFAGEATLRRIYGTWEHNMINHL 3567

  Fly  3947 ---SFFRTGILATCSAVLDPTPFYEMCMDLGMKSPPIRKGHPAVKGACAAALAYIEACTALKVPM 4008
               |:|.|....||.|.|:.:|:                                ...|.|:|.:
  Rat  3568 QVFSYFDTKGKQTCRATLELSPW--------------------------------TMSTLLQVHV 3600

  Fly  4009 RVPSQCVFCQLSNGSYVPEGTFMELS--GPEIPKSSDVVFIVEAKECNANLKTSKN--IMTVVSS 4069
            ..||     .|.:..:..:...::.|  ..::...|:|....:..:.||:....:.  .:.:..|
  Rat  3601 SQPS-----PLFDLHHFDQEVILKASTKNQKVSWKSEVQVESQVLQHNAHFSNDQEEVRLDIAGS 3660

  Fly  4070 IEEQLQAAKITNNRYAVVAFG----------GVSPYDKARSVIYEHNEFTSKP---------EQL 4115
            :|.||...:    .:.:.|||          |...|.:|.:.::    :|..|         ::|
  Rat  3661 LEGQLWDLE----NFFLPAFGKSLRELLQIDGKRQYLQASTSLH----YTKNPNGYLLSLPVQEL 3717

  Fly  4116 ADYFGHINTGNGSSNDILMAISAAAKLNFRPGVSKTFILLSCSKCAARDMRFDYTSILQYLLEEG 4180
            .|.|                |....|||...|: |.:..||.|..|                   
  Rat  3718 TDRF----------------IIPGLKLNDFSGI-KIYKKLSTSPFA------------------- 3746

  Fly  4181 VNLHILADTEFDFERNKKLRHFFGLDSKLVYSKRFPEGDAETRNTTHIPKSNLGICTTLAVETQG 4245
            :||.:|...:|.           |:|....|||  |||.:.....|.||:..|.:          
  Rat  3747 LNLTMLPKVKFP-----------GVDLLTQYSK--PEGSSVPTFETTIPEIQLTV---------- 3788

  Fly  4246 SVFSARKLQP--ERKYPIKRFATIFAKRVALSATPIQSQTCE 4285
            |.|:..|..|  ...:.:.:...:.|. |.|.:..:..||.|
  Rat  3789 SQFTLPKSFPVGNTVFDLNKLTNLIAD-VDLPSITLPEQTIE 3829

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ApoltpNP_995670.2 LPD_N 49..633 CDD:214755 140/626 (22%)
DUF1943 665..1012 CDD:286281 80/363 (22%)
DUF1081 1029..1122 CDD:283982 24/95 (25%)
VWD 3741..3908 CDD:295339 35/208 (17%)
C8 3951..4014 CDD:285899 11/63 (17%)
ApobNP_062160.2 LPD_N 46..598 CDD:214755 141/629 (22%)
DUF1943 633..945 CDD:286281 79/362 (22%)
DUF1081 962..1063 CDD:283982 29/132 (22%)
COG1340 2206..2485 CDD:224259 56/291 (19%)
ApoB100_C 4435..4491 CDD:289274
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 T131220
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.